Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	117283
Gene name	Inositol hexakisphosphate kinase 3
Gene symbol	IP6K3
Synonyms (NCBI Gene)	IHPK3INSP6K3
Chromosome	6
Chromosome location	6p21.31
Summary	This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,

Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038242	hsa-miR-330-5p	CLASH	23622248
MIRT727440	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727439	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727438	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727436	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727437	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT1068443	hsa-miR-2276	CLIP-seq
MIRT1068444	hsa-miR-4286	CLIP-seq
MIRT2016661	hsa-miR-2053	CLIP-seq
MIRT2016662	hsa-miR-214	CLIP-seq
MIRT2016663	hsa-miR-30a	CLIP-seq
MIRT2016664	hsa-miR-30b	CLIP-seq
MIRT2016665	hsa-miR-30c	CLIP-seq
MIRT2016666	hsa-miR-30d	CLIP-seq
MIRT2016667	hsa-miR-30e	CLIP-seq
MIRT2016668	hsa-miR-3619-5p	CLIP-seq
MIRT2016669	hsa-miR-3680	CLIP-seq
MIRT2016670	hsa-miR-375	CLIP-seq
MIRT2016671	hsa-miR-3922-5p	CLIP-seq
MIRT2016672	hsa-miR-4291	CLIP-seq
MIRT2016673	hsa-miR-4639-3p	CLIP-seq
MIRT2016674	hsa-miR-4680-5p	CLIP-seq
MIRT2016675	hsa-miR-569	CLIP-seq
MIRT2016676	hsa-miR-643	CLIP-seq
MIRT2016677	hsa-miR-646	CLIP-seq
MIRT2016678	hsa-miR-761	CLIP-seq
MIRT2016679	hsa-miR-889	CLIP-seq
MIRT2016680	hsa-miR-922	CLIP-seq
MIRT1068443	hsa-miR-2276	CLIP-seq
MIRT1068444	hsa-miR-4286	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000827	Function	Inositol-1,3,4,5,6-pentakisphosphate kinase activity	IEA
GO:0000827	Function	Inositol-1,3,4,5,6-pentakisphosphate kinase activity	TAS
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IBA
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IDA	11502751
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IEA
GO:0000828	Function	Inositol hexakisphosphate kinase activity	TAS
GO:0000829	Function	Diphosphoinositol pentakisphosphate kinase activity	IEA
GO:0000829	Function	Diphosphoinositol pentakisphosphate kinase activity	TAS
GO:0000831	Function	Inositol hexakisphosphate 6-kinase activity	IDA	11502751
GO:0000832	Function	Inositol hexakisphosphate 5-kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11502751
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	11502751
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032958	Process	Inositol phosphate biosynthetic process	IBA
GO:0032958	Process	Inositol phosphate biosynthetic process	IDA	11502751
GO:0032958	Process	Inositol phosphate biosynthetic process	IEA
GO:0040011	Process	Locomotion	IEA
GO:0043647	Process	Inositol phosphate metabolic process	IEA
GO:0043647	Process	Inositol phosphate metabolic process	TAS
GO:0046488	Process	Phosphatidylinositol metabolic process	IDA	11502751
GO:0046488	Process	Phosphatidylinositol metabolic process	IEA
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IBA
GO:0052836	Function	Inositol 5-diphosphate pentakisphosphate 5-kinase activity	IEA
GO:0052836	Function	Inositol 5-diphosphate pentakisphosphate 5-kinase activity	TAS
GO:0052839	Function	Diphosphoinositol tetrakisphosphate kinase activity	IEA
GO:0052839	Function	Diphosphoinositol tetrakisphosphate kinase activity	TAS
GO:0090407	Process	Organophosphate biosynthetic process	IEA

MIM	HGNC	e!Ensembl
606993	17269	ENSG00000161896

Q96PC2

Protein name

Inositol hexakisphosphate kinase 3 (InsP6 kinase 3) (EC 2.7.4.21) (Inositol hexaphosphate kinase 3)

Protein function

Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03770	IPK	198 → 404	Inositol polyphosphate kinase	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain.

Sequence

MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKR
FTPQYKGTVTVHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSD
CTLAQWPHAQLARSPKESPAKALLRSEPHLNTPAFSLVEDTNGNQVERKSFNPWGLQCHQ
AHLTRLCSEYPENKRHRFLLLENVVSQYTHPCVLDLKMGTRQHGDDASEEKKARHMRKCA
QSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGFRQALYQFLHNGSHLRRELLE
PILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGL
TKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE

Sequence length

410

Interactions

View interactions

	KEGG		Reactome
	Phosphatidylinositol signaling system		Synthesis of pyrophosphates in the cytosol

IP6K3 (inositol hexakisphosphate kinase 3)