Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	117283
Gene name Gene Name - the full gene name approved by the HGNC.	Inositol hexakisphosphate kinase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IP6K3
Synonyms (NCBI Gene) Gene synonyms aliases	IHPK3, INSP6K3
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p21.31
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,

Show/Hide all(30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT038242	hsa-miR-330-5p	CLASH	23622248
MIRT727440	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727439	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727438	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727436	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727437	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT1068443	hsa-miR-2276	CLIP-seq
MIRT1068444	hsa-miR-4286	CLIP-seq
MIRT2016661	hsa-miR-2053	CLIP-seq
MIRT2016662	hsa-miR-214	CLIP-seq
MIRT2016663	hsa-miR-30a	CLIP-seq
MIRT2016664	hsa-miR-30b	CLIP-seq
MIRT2016665	hsa-miR-30c	CLIP-seq
MIRT2016666	hsa-miR-30d	CLIP-seq
MIRT2016667	hsa-miR-30e	CLIP-seq
MIRT2016668	hsa-miR-3619-5p	CLIP-seq
MIRT2016669	hsa-miR-3680	CLIP-seq
MIRT2016670	hsa-miR-375	CLIP-seq
MIRT2016671	hsa-miR-3922-5p	CLIP-seq
MIRT2016672	hsa-miR-4291	CLIP-seq
MIRT2016673	hsa-miR-4639-3p	CLIP-seq
MIRT2016674	hsa-miR-4680-5p	CLIP-seq
MIRT2016675	hsa-miR-569	CLIP-seq
MIRT2016676	hsa-miR-643	CLIP-seq
MIRT2016677	hsa-miR-646	CLIP-seq
MIRT2016678	hsa-miR-761	CLIP-seq
MIRT2016679	hsa-miR-889	CLIP-seq
MIRT2016680	hsa-miR-922	CLIP-seq
MIRT1068443	hsa-miR-2276	CLIP-seq
MIRT1068444	hsa-miR-4286	CLIP-seq

Show/Hide all(21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000827	Function	Inositol-1,3,4,5,6-pentakisphosphate kinase activity	IEA
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IBA	21873635
GO:0000828	Function	Inositol hexakisphosphate kinase activity	IDA	11502751
GO:0000831	Function	Inositol hexakisphosphate 6-kinase activity	IDA	11502751
GO:0000832	Function	Inositol hexakisphosphate 5-kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	11502751
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	11502751
GO:0016301	Function	Kinase activity	IBA	21873635
GO:0032958	Process	Inositol phosphate biosynthetic process	IBA	21873635
GO:0032958	Process	Inositol phosphate biosynthetic process	IDA	11502751
GO:0040011	Process	Locomotion	IEA
GO:0043647	Process	Inositol phosphate metabolic process	TAS
GO:0046488	Process	Phosphatidylinositol metabolic process	IDA	11502751
GO:0046854	Process	Phosphatidylinositol phosphorylation	IBA	21873635
GO:0052723	Function	Inositol hexakisphosphate 1-kinase activity	IEA
GO:0052724	Function	Inositol hexakisphosphate 3-kinase activity	IEA

MIM	HGNC	e!Ensembl
606993	17269	ENSG00000161896

Protein

UniProt ID

Q96PC2

Protein name

Inositol hexakisphosphate kinase 3 (InsP6 kinase 3) (EC 2.7.4.21) (Inositol hexaphosphate kinase 3)

Protein function

Converts inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). Converts 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03770	IPK	198 → 404	Inositol polyphosphate kinase	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain.

Sequence

MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKR
FTPQYKGTVTVHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSD
CTLAQWPHAQLARSPKESPAKALLRSEPHLNTPAFSLVEDTNGNQVERKSFNPWGLQCHQ
AHLTRLCSEYPENKRHRFLLLENVVSQYTHPCVLDLKMGTRQHGDDASEEKKARHMRKCA
QSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGFRQALYQFLHNGSHLRRELLE
PILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGL
TKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE

Sequence length

410

Interactions

View interactions

	KEGG		Reactome
	Phosphatidylinositol signaling system		Synthesis of pyrophosphates in the cytosol

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912 View all (22 more)	30595370
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	19503088, 17804836, 21156761
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	31374203

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Metabolic Syndrome	Metabolic Syndrome	GWAS
Insomnia	Insomnia	GWAS
Otosclerosis	Otosclerosis	GWAS
Asthma	Asthma	GWAS

Show/Hide Text Mining Associations (2)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	27345265
Inflammatory Bowel Diseases	Associate	31185018

IP6K3 (inositol hexakisphosphate kinase 3)