Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
117247
Gene name Gene Name - the full gene name approved by the HGNC.
Solute carrier family 16 member 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SLC16A10
Synonyms (NCBI Gene) Gene synonyms aliases
MCT10, PRO0813, TAT1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q21
Summary Summary of gene provided in NCBI Entrez Gene.
SLC16A10 is a member of a family of plasma membrane amino acid transporters that mediate the Na(+)-independent transport of aromatic amino acids across the plasma membrane.[supplied by OMIM, Apr 2004]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT002409 hsa-miR-21-5p Microarray 18591254
MIRT666322 hsa-miR-140-3p HITS-CLIP 21572407
MIRT706751 hsa-miR-4418 HITS-CLIP 21572407
MIRT706750 hsa-miR-509-3-5p HITS-CLIP 21572407
MIRT706749 hsa-miR-509-5p HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003333 Process Amino acid transmembrane transport IEA
GO:0005302 Function L-tyrosine transmembrane transporter activity IDA 11827462
GO:0005302 Function L-tyrosine transmembrane transporter activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607550 17027 ENSG00000112394
Protein
UniProt ID Q8TF71
Protein name Monocarboxylate transporter 10 (MCT 10) (Aromatic amino acid transporter 1) (Solute carrier family 16 member 10) (T-type amino acid transporter 1)
Protein function Sodium- and proton-independent thyroid hormones and aromatic acids transporter (PubMed:11827462, PubMed:18337592, PubMed:28754537). Mediates both uptake and efflux of 3,5,3'-triiodothyronine (T3) and 3,5,3',5'-tetraiodothyronine (T4) with high a
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07690 MFS_1 74 379 Major Facilitator Superfamily Family
PF07690 MFS_1 303 509 Major Facilitator Superfamily Family
Tissue specificity TISSUE SPECIFICITY: Strongly expressed in kidney and skeletal muscle and at lower level in placenta and heart. {ECO:0000269|PubMed:11827462}.
Sequence
MVLSQEEPDSARGTSEAQPLGPAPTGAAPPPGPGPSDSPEAAVEKVEVELAGPATAEPHE
PPEPPEGGWGWLVMLAAMWCNGSVFGIQNACGVLFVSMLETFGSKDDDKMVFKTAWVGSL
SMGMIFFCCPIVSVFTDLFGCRKTAVVGAAVGFVGLMSSSFVSSIEPLYLTYGIIFACGC
SFAYQPSLVILGHYFKKRLGLVNGIVTAGSSVFTILLPLLLRVLIDSVGLFYTLRVLCIF
MFVLFLAGFTYRPLATSTKDKESGGSGSSLFSRKKFSPPKKIFNFAIFKVTAYAVWAVGI
PL
ALFGYFVPYVHLMKHVNERFQDEKNKEVVLMCIGVTSGVGRLLFGRIADYVPGVKKVY
LQVLSFFFIGLMSMMIPLC
SIFGALIAVCLIMGLFDGCFISIMAPIAFELVGAQDVSQAI
GFLLGFMSIPMTVGPPIAGLLRDKLGSYDVAFYLAGVPPLIGGAVLCFIPWIHSKKQREI
SKTTGKEKMEKMLENQNSLLSSSSGMFKK
ESDSII
Sequence length 515
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hormone signaling
Thyroid hormone signaling pathway
Protein digestion and absorption
  Amino acid transport across the plasma membrane
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Psoriasis Psoriasis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Diabetes Mellitus Associate 36340268
Fetal Growth Retardation Associate 20167367
Kidney Failure Chronic Stimulate 35908957