MRGPRX2 (MAS related GPR family member X2)

Gene

• Entrez ID: 117194
• Gene name: MAS related GPR family member X2
• Gene symbol: MRGPRX2
• Synonyms (NCBI Gene): MGRG3, MRGX2
• Chromosome: 11
• Chromosome location: 11p15.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1158058	hsa-miR-489	CLIP-seq
MIRT2045226	hsa-miR-450b-5p	CLIP-seq
MIRT2045227	hsa-miR-518a-5p	CLIP-seq
MIRT2045228	hsa-miR-527	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	12915402, 22069323
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IC	12915402
GO:0016020	Component	Membrane	IEA
GO:0019233	Process	Sensory perception of pain	NAS	12915402
GO:0030431	Process	Sleep	NAS	12915402
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0042923	Function	Neuropeptide binding	IPI	12915402
GO:0043303	Process	Mast cell degranulation	IDA	22069323
GO:0045576	Process	Mast cell activation	IDA	25517090
GO:1990595	Function	Mast cell secretagogue receptor activity	ISS

Other IDs

• MIM: 607228
• HGNC: 17983
• e!Ensembl: ENSG00000183695

Protein

• UniProt ID: Q96LB1
• Protein name: Mas-related G-protein coupled receptor member X2
• Protein function: Mast cell-specific receptor for basic secretagogues, i.e. cationic amphiphilic drugs, as well as endo- or exogenous peptides, consisting of a basic head group and a hydrophobic core (PubMed:25517090). Recognizes and binds small molecules contain
• PDB: 7S8L, 7S8M, 7S8N, 7S8O, 7VDH, 7VDL, 7VDM, 7VUY, 7VUZ, 7VV0, 7VV3, 7VV4, 7VV5, 7VV6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	47 → 279	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in mast cells. Has a limited expression profile, both peripheral and within the central nervous system, with highest levels in dorsal root ganglion (PubMed:12915402). Detected in blood vessels, scattered lymphocytes, a
• Sequence:

  MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMR
  RNAFSVYVLSLAGADFLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSML
  STVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLLSILEGKFCGFLFSDGDSGWC
  QTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG
  IQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLAL
  QRALQDIAEVDHSEGCFRQGTPEMSRSSLV

• Sequence length: 330

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Anaphylaxis	Associate	30072729, 34385999	★☆☆☆☆ Found in Text Mining only
Asthma	Associate	33790895	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Stimulate	28694291	★☆☆☆☆ Found in Text Mining only
Chronic Urticaria	Associate	33790895, 34090787	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Associate	33790895	★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	30072729, 34385999, 36726977	★☆☆☆☆ Found in Text Mining only
Eczema	Associate	33429916	★☆☆☆☆ Found in Text Mining only
Inflammation	Stimulate	28694291	★☆☆☆☆ Found in Text Mining only
Mastocytosis	Associate	38022672	★☆☆☆☆ Found in Text Mining only
Mastocytosis Cutaneous	Associate	35958589	★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Stimulate	35958589	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Associate	38022672	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	16161007	★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Associate	16161007	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Associate	28694291	★☆☆☆☆ Found in Text Mining only
Prurigo	Associate	38022672	★☆☆☆☆ Found in Text Mining only
Pruritus	Associate	33429916, 38022672	★☆☆☆☆ Found in Text Mining only
Skin Diseases	Associate	33429916, 35958589, 38022672	★☆☆☆☆ Found in Text Mining only
Urticaria	Associate	38022672	★☆☆☆☆ Found in Text Mining only