Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	116985
Gene name Gene Name - the full gene name approved by the HGNC.	ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ARAP1
Synonyms (NCBI Gene) Gene synonyms aliases	CENTD2, cnt-d2
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q13.4
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene contains SAM, ARF-GAP, RHO-GAP, ankyrin repeat, RAS-associating, and pleckstrin homology (PH) domains. In vitro, this protein displays RHO-GAP and phosphatidylinositol (3,4,5) trisphosphate (PIP3)-dependent ARF-GAP activit

Show/Hide all(101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042346	hsa-miR-484	CLASH	23622248
MIRT040872	hsa-miR-18a-3p	CLASH	23622248
MIRT646433	hsa-miR-4323	HITS-CLIP	23824327
MIRT646432	hsa-miR-4267	HITS-CLIP	23824327
MIRT646431	hsa-miR-938	HITS-CLIP	23824327
MIRT646430	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT646428	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT646429	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT738040	hsa-miR-4641	HITS-CLIP	33718276
MIRT738036	hsa-miR-4457	HITS-CLIP	33718276
MIRT738037	hsa-miR-4758-3p	HITS-CLIP	33718276
MIRT646433	hsa-miR-4323	HITS-CLIP	33718276
MIRT738038	hsa-miR-766	HITS-CLIP	33718276
MIRT738039	hsa-miR-3925-3p	HITS-CLIP	33718276
MIRT738040	hsa-miR-4641	HITS-CLIP	33718276
MIRT646433	hsa-miR-4323	HITS-CLIP	23824327
MIRT646432	hsa-miR-4267	HITS-CLIP	23824327
MIRT646431	hsa-miR-938	HITS-CLIP	23824327
MIRT646430	hsa-miR-6886-3p	HITS-CLIP	23824327
MIRT646428	hsa-miR-3157-3p	HITS-CLIP	23824327
MIRT646429	hsa-miR-874-3p	HITS-CLIP	23824327
MIRT2173659	hsa-miR-1245b-5p	CLIP-seq
MIRT2173660	hsa-miR-1972	CLIP-seq
MIRT2173661	hsa-miR-3142	CLIP-seq
MIRT2173662	hsa-miR-3936	CLIP-seq
MIRT2173663	hsa-miR-432	CLIP-seq
MIRT2173664	hsa-miR-4650-5p	CLIP-seq
MIRT2477247	hsa-miR-1224-3p	CLIP-seq
MIRT2173659	hsa-miR-1245b-5p	CLIP-seq
MIRT2477248	hsa-miR-1260	CLIP-seq
MIRT2477249	hsa-miR-1260b	CLIP-seq
MIRT2477250	hsa-miR-1265	CLIP-seq
MIRT2477251	hsa-miR-1280	CLIP-seq
MIRT2477252	hsa-miR-149	CLIP-seq
MIRT2173660	hsa-miR-1972	CLIP-seq
MIRT2477253	hsa-miR-2392	CLIP-seq
MIRT2477254	hsa-miR-24	CLIP-seq
MIRT2477255	hsa-miR-299-3p	CLIP-seq
MIRT2173661	hsa-miR-3142	CLIP-seq
MIRT2477256	hsa-miR-3151	CLIP-seq
MIRT2477257	hsa-miR-342-5p	CLIP-seq
MIRT2477258	hsa-miR-3605-5p	CLIP-seq
MIRT2477259	hsa-miR-370	CLIP-seq
MIRT2477260	hsa-miR-3940-5p	CLIP-seq
MIRT2477261	hsa-miR-4265	CLIP-seq
MIRT2477262	hsa-miR-4284	CLIP-seq
MIRT2477263	hsa-miR-4296	CLIP-seq
MIRT2173663	hsa-miR-432	CLIP-seq
MIRT2477264	hsa-miR-4322	CLIP-seq
MIRT2477265	hsa-miR-4447	CLIP-seq
MIRT2477266	hsa-miR-4472	CLIP-seq
MIRT2477267	hsa-miR-4507	CLIP-seq
MIRT2477268	hsa-miR-4534	CLIP-seq
MIRT2173664	hsa-miR-4650-5p	CLIP-seq
MIRT2477269	hsa-miR-4651	CLIP-seq
MIRT2477270	hsa-miR-4664-5p	CLIP-seq
MIRT2477271	hsa-miR-4764-5p	CLIP-seq
MIRT2477272	hsa-miR-4802-5p	CLIP-seq
MIRT2477273	hsa-miR-491-5p	CLIP-seq
MIRT2477274	hsa-miR-501-3p	CLIP-seq
MIRT2477275	hsa-miR-502-3p	CLIP-seq
MIRT2477276	hsa-miR-532-3p	CLIP-seq
MIRT2477277	hsa-miR-608	CLIP-seq
MIRT2477278	hsa-miR-765	CLIP-seq
MIRT2477247	hsa-miR-1224-3p	CLIP-seq
MIRT2173659	hsa-miR-1245b-5p	CLIP-seq
MIRT2477248	hsa-miR-1260	CLIP-seq
MIRT2477249	hsa-miR-1260b	CLIP-seq
MIRT2477250	hsa-miR-1265	CLIP-seq
MIRT2477251	hsa-miR-1280	CLIP-seq
MIRT2477252	hsa-miR-149	CLIP-seq
MIRT2173660	hsa-miR-1972	CLIP-seq
MIRT2477253	hsa-miR-2392	CLIP-seq
MIRT2477254	hsa-miR-24	CLIP-seq
MIRT2477255	hsa-miR-299-3p	CLIP-seq
MIRT2173661	hsa-miR-3142	CLIP-seq
MIRT2477256	hsa-miR-3151	CLIP-seq
MIRT2477257	hsa-miR-342-5p	CLIP-seq
MIRT2477258	hsa-miR-3605-5p	CLIP-seq
MIRT2477259	hsa-miR-370	CLIP-seq
MIRT2477260	hsa-miR-3940-5p	CLIP-seq
MIRT2477261	hsa-miR-4265	CLIP-seq
MIRT2477262	hsa-miR-4284	CLIP-seq
MIRT2477263	hsa-miR-4296	CLIP-seq
MIRT2173663	hsa-miR-432	CLIP-seq
MIRT2477264	hsa-miR-4322	CLIP-seq
MIRT2477265	hsa-miR-4447	CLIP-seq
MIRT2477266	hsa-miR-4472	CLIP-seq
MIRT2477267	hsa-miR-4507	CLIP-seq
MIRT2477268	hsa-miR-4534	CLIP-seq
MIRT2173664	hsa-miR-4650-5p	CLIP-seq
MIRT2477269	hsa-miR-4651	CLIP-seq
MIRT2477270	hsa-miR-4664-5p	CLIP-seq
MIRT2477271	hsa-miR-4764-5p	CLIP-seq
MIRT2477272	hsa-miR-4802-5p	CLIP-seq
MIRT2477273	hsa-miR-491-5p	CLIP-seq
MIRT2477274	hsa-miR-501-3p	CLIP-seq
MIRT2477275	hsa-miR-502-3p	CLIP-seq
MIRT2477276	hsa-miR-532-3p	CLIP-seq
MIRT2477277	hsa-miR-608	CLIP-seq
MIRT2477278	hsa-miR-765	CLIP-seq

Show/Hide all(55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	IEA
GO:0001921	Process	Positive regulation of receptor recycling	IEA
GO:0002090	Process	Regulation of receptor internalization	IMP	18939958
GO:0002102	Component	Podosome	IEA
GO:0002102	Component	Podosome	ISS
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	11804590, 19666464
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	15607035, 16169070, 18165900
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IBA
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	11804589, 18939958, 19666464
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0005771	Component	Multivesicular body	IDA	18939958
GO:0005771	Component	Multivesicular body	IEA
GO:0005794	Component	Golgi apparatus	IDA	11804590, 18939958
GO:0005794	Component	Golgi apparatus	IEA
GO:0005795	Component	Golgi stack	IEA
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0007015	Process	Actin filament organization	TAS	11804590
GO:0007165	Process	Signal transduction	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008360	Process	Regulation of cell shape	IMP	11804590
GO:0016020	Component	Membrane	IEA
GO:0019897	Component	Extrinsic component of plasma membrane	IDA	18939958
GO:0030100	Process	Regulation of endocytosis	IEA
GO:0031344	Process	Regulation of cell projection organization	IBA
GO:0031702	Function	Type 1 angiotensin receptor binding	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0042995	Component	Cell projection	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	11804590
GO:0045124	Process	Regulation of bone resorption	IEA
GO:0045124	Process	Regulation of bone resorption	ISS
GO:0045494	Process	Photoreceptor cell maintenance	IEA
GO:0045494	Process	Photoreceptor cell maintenance	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	IMP	11804590
GO:0051497	Process	Negative regulation of stress fiber assembly	IMP	11804590
GO:0070161	Component	Anchoring junction	IEA

MIM	HGNC	e!Ensembl
606646	16925	ENSG00000186635

Protein

UniProt ID

Q96P48

Protein name

Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 (Centaurin-delta-2) (Cnt-d2)

Protein function

Phosphatidylinositol 3,4,5-trisphosphate-dependent GTPase-activating protein that modulates actin cytoskeleton remodeling by regulating ARF and RHO family members (PubMed:11804590, PubMed:19666464). Activated by phosphatidylinositol 3,4,5-trisph

PDB

4X1V

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00536	SAM_1	7 → 68	SAM domain (Sterile alpha motif)	Domain
PF00169	PH	328 → 419	PH domain	Domain
PF01412	ArfGap	535 → 653	Putative GTPase activating protein for Arf	Domain
PF00169	PH	744 → 849	PH domain	Domain
PF00620	RhoGAP	971 → 1123	RhoGAP domain	Domain
PF00788	RA	1172 → 1261	Ras association (RalGDS/AF-6) domain	Domain
PF00169	PH	1275 → 1396	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in heart, skeletal muscle, spleen, kidney, liver, placenta, lung, peripheral blood leukocytes, adrenal gland, bone marrow, brain, lymph node, mammary gland, prostate, spinal cord, stomach, thyroid and trachea. {ECO:0000269|Pub

Sequence

MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRI
LAGLLRAHTSPAPAPRPTPRPVPMKRHIFRSPPVPATPPEPLPTTTEDEGLPAAPPIPPR
RSCLPPTCFTTPSTAAPDPVLPPLPAKRHLAELSVPPVPPRTGPPRLLVSLPTKEEESLL
PSLSSPPQPQSEEPLSTLPQGPPQPPSPPPCPPEIPPKPVRLFPEFDDSDYDEVPEEGPG
APARVMTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGGWHTSS
LSLSLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYF
DSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAE
QRARARLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGI
TFIDMSVGNVKEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAER
IWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET
LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQE
ELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNR
TTEVPRLDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGV
LSYFENERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHE
WVKCIAKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPC
EEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTL
SEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEG
EQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRA
TVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS
VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAE
ELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQ
AMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSQ
RPWSGAPETSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDT
QMELREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFT
ADPLSLLRNV

Sequence length

1450

Interactions

View interactions

	KEGG		Reactome
	Endocytosis		Rho GTPase cycle PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Body mass index and type 2 diabetes (pairwise), Body fat percentage and type 2 diabetes (pairwise), Type 2 diabetes (PheCode 250.2), Type 2 diabetes, Type 2 diabetes (adjusted for BMI)	N/A	N/A	GWAS
Insomnia	Insomnia	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (19)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35291911
Arthritis Rheumatoid	Associate	23577190
Breast Neoplasms	Associate	20554524, 32110804
Carcinoma Renal Cell	Associate	34516333
Colorectal Neoplasms	Associate	32141550
Diabetes Gestational	Associate	25973943
Diabetes Mellitus	Associate	22662265
Diabetes Mellitus Type 2	Associate	21267535, 22662265, 25587982, 30089489, 32260174, 32578971, 32922204
Diabetes Mellitus Type 2	Stimulate	21873549, 30089489
Insulin Resistance	Associate	30089489
Lymphatic Metastasis	Stimulate	32141550
Lymphoma	Associate	37599524
Neoplasms	Associate	32110804, 32985327, 37599524
Neoplasms	Stimulate	34516333
Primary Release Disorder Of Platelets	Stimulate	32260174
Primary Release Disorder Of Platelets	Associate	32260174
Stomach Neoplasms	Stimulate	32141550
Urinary Bladder Neoplasms	Associate	32141550, 32985327
Uterine Cervical Neoplasms	Associate	32985327

ARAP1 (ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1)