CLNK (cytokine dependent hematopoietic cell linker)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 116449
Gene name Cytokine dependent hematopoietic cell linker
Gene symbol CLNK
Synonyms (NCBI Gene)
MIST
Chromosome 4
Chromosome location 4p16.1
Summary MIST is a member of the SLP76 family of adaptors (see LCP2, MIM 601603; BLNK, MIM 604515). MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma (PLCG1; MIM 172420)-mediated B cell antigen receptor (BCR) signaling and FC-eps
miRNA miRNA information provided by mirtarbase database.
131
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (131)
miRTarBase ID miRNA Experiments Reference
MIRT650701 hsa-miR-548ac HITS-CLIP 23824327
MIRT650700 hsa-miR-548bb-3p HITS-CLIP 23824327
MIRT650699 hsa-miR-548d-3p HITS-CLIP 23824327
MIRT650698 hsa-miR-548h-3p HITS-CLIP 23824327
MIRT650697 hsa-miR-548z HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (13)
GO ID Ontology Definition Evidence Reference
GO:0002729 Process Positive regulation of natural killer cell cytokine production IEA
GO:0005515 Function Protein binding IPI 16273093, 26009488
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm IMP 26009488
GO:0007169 Process Cell surface receptor protein tyrosine kinase signaling pathway IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
611434 17438 ENSG00000109684
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z7G1
Protein name Cytokine-dependent hematopoietic cell linker (Mast cell immunoreceptor signal transducer)
Protein function An adapter protein which plays a role in the regulation of immunoreceptor signaling, including PLC-gamma-mediated B-cell antigen receptor (BCR) signaling and FC-epsilon R1-mediated mast cell degranulation (By similarity). Together with FGR, it a
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 309 → 392 SH2 domain Domain
Sequence 
MNRQGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDG
AKGHSDDDYDDPELRMEETWQSIKILPARPIKESEYADTHYFKVAMDTPLPLDTRTSISI
GQPTWNTQTRLERVDKPISKDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPLPPEP
ESSRPPLSQRHTFPEVQRMPSQISLRDLSEVLEAEKVPHNQRKPESTHLLENQNTQEIPL
AISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPHENILPYKYTSWRPPFPKRSD
RKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVK
IRFLERNQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPLP
LTRHLLPL
Sequence length 428
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
CLNK-related disorder Likely benign rs189581402, rs190441710 RCV003937036
RCV003971536
Show/Hide Text Mining Associations (1)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34887858