CLNK (cytokine dependent hematopoietic cell linker)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
116449
Gene name Gene Name - the full gene name approved by the HGNC.
Cytokine dependent hematopoietic cell linker
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CLNK
Synonyms (NCBI Gene) Gene synonyms aliases
MIST
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p16.1
Summary Summary of gene provided in NCBI Entrez Gene.
MIST is a member of the SLP76 family of adaptors (see LCP2, MIM 601603; BLNK, MIM 604515). MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma (PLCG1; MIM 172420)-mediated B cell antigen receptor (BCR) signaling and FC-eps
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(131)
miRTarBase ID miRNA Experiments Reference
MIRT650701 hsa-miR-548ac HITS-CLIP 23824327
MIRT650700 hsa-miR-548bb-3p HITS-CLIP 23824327
MIRT650699 hsa-miR-548d-3p HITS-CLIP 23824327
MIRT650698 hsa-miR-548h-3p HITS-CLIP 23824327
MIRT650697 hsa-miR-548z HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0002729 Process Positive regulation of natural killer cell cytokine production IEA
GO:0005515 Function Protein binding IPI 16273093, 26009488
GO:0005737 Component Cytoplasm IEA
GO:0005737 Component Cytoplasm IMP 26009488
GO:0007169 Process Cell surface receptor protein tyrosine kinase signaling pathway IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
611434 17438 ENSG00000109684
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q7Z7G1
Protein name Cytokine-dependent hematopoietic cell linker (Mast cell immunoreceptor signal transducer)
Protein function An adapter protein which plays a role in the regulation of immunoreceptor signaling, including PLC-gamma-mediated B-cell antigen receptor (BCR) signaling and FC-epsilon R1-mediated mast cell degranulation (By similarity). Together with FGR, it a
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 309 → 392 SH2 domain Domain
Sequence 
MNRQGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDG
AKGHSDDDYDDPELRMEETWQSIKILPARPIKESEYADTHYFKVAMDTPLPLDTRTSISI
GQPTWNTQTRLERVDKPISKDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPLPPEP
ESSRPPLSQRHTFPEVQRMPSQISLRDLSEVLEAEKVPHNQRKPESTHLLENQNTQEIPL
AISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPHENILPYKYTSWRPPFPKRSD
RKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVK
IRFLERNQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPLP
LTRHLLPL
Sequence length 428
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (6)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Adipsin levels in type 2 diabetes N/A N/A GWAS
Gout Gout N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34887858