Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	116448
Gene name	Oligodendrocyte transcription factor 1
Gene symbol	OLIG1
Synonyms (NCBI Gene)	BHLHB6BHLHE21
Chromosome	21
Chromosome location	21q22.11

Show/Hide all (47)

miRTarBase ID	miRNA	Experiments
MIRT1203286	hsa-miR-1181	CLIP-seq
MIRT1203287	hsa-miR-1207-3p	CLIP-seq
MIRT1203288	hsa-miR-1262	CLIP-seq
MIRT1203289	hsa-miR-2110	CLIP-seq
MIRT1203290	hsa-miR-3150a-3p	CLIP-seq
MIRT1203291	hsa-miR-3153	CLIP-seq
MIRT1203292	hsa-miR-4258	CLIP-seq
MIRT1203293	hsa-miR-4260	CLIP-seq
MIRT1203294	hsa-miR-4271	CLIP-seq
MIRT1203295	hsa-miR-4701-3p	CLIP-seq
MIRT1203296	hsa-miR-4725-3p	CLIP-seq
MIRT1203297	hsa-miR-4727-5p	CLIP-seq
MIRT1203298	hsa-miR-544	CLIP-seq
MIRT2058702	hsa-miR-3686	CLIP-seq
MIRT1203292	hsa-miR-4258	CLIP-seq
MIRT2058703	hsa-miR-4778-5p	CLIP-seq
MIRT2058704	hsa-miR-624	CLIP-seq
MIRT2286870	hsa-miR-1908	CLIP-seq
MIRT2286871	hsa-miR-1915	CLIP-seq
MIRT2286872	hsa-miR-3180	CLIP-seq
MIRT2286873	hsa-miR-3180-3p	CLIP-seq
MIRT2286874	hsa-miR-3196	CLIP-seq
MIRT2286875	hsa-miR-4447	CLIP-seq
MIRT2286876	hsa-miR-4472	CLIP-seq
MIRT2286877	hsa-miR-4488	CLIP-seq
MIRT2286878	hsa-miR-4651	CLIP-seq
MIRT2286879	hsa-miR-4697-5p	CLIP-seq
MIRT2286880	hsa-miR-4706	CLIP-seq
MIRT2286881	hsa-miR-4726-3p	CLIP-seq
MIRT2286882	hsa-miR-4749-5p	CLIP-seq
MIRT2286883	hsa-miR-608	CLIP-seq
MIRT2286884	hsa-miR-663	CLIP-seq
MIRT2286870	hsa-miR-1908	CLIP-seq
MIRT2286871	hsa-miR-1915	CLIP-seq
MIRT2286872	hsa-miR-3180	CLIP-seq
MIRT2286873	hsa-miR-3180-3p	CLIP-seq
MIRT2286874	hsa-miR-3196	CLIP-seq
MIRT2286875	hsa-miR-4447	CLIP-seq
MIRT2286876	hsa-miR-4472	CLIP-seq
MIRT2286877	hsa-miR-4488	CLIP-seq
MIRT2286878	hsa-miR-4651	CLIP-seq
MIRT2286879	hsa-miR-4697-5p	CLIP-seq
MIRT2286880	hsa-miR-4706	CLIP-seq
MIRT2286881	hsa-miR-4726-3p	CLIP-seq
MIRT2286882	hsa-miR-4749-5p	CLIP-seq
MIRT2286883	hsa-miR-608	CLIP-seq
MIRT2286884	hsa-miR-663	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	18923419, 25814554
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0007423	Process	Sensory organ development	IBA
GO:0014003	Process	Oligodendrocyte development	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048663	Process	Neuron fate commitment	IEA
GO:0061564	Process	Axon development	IBA
GO:0070888	Function	E-box binding	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
606385	16983	ENSG00000184221

Q8TAK6

Protein name

Oligodendrocyte transcription factor 1 (Oligo1) (Class B basic helix-loop-helix protein 6) (bHLHb6) (Class E basic helix-loop-helix protein 21) (bHLHe21)

Protein function

Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	106 → 165	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable. {ECO:0000269|PubMed:11526205}.

Sequence

MYYAVSQARVNAVPGTMLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSST
TAPLLPKAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERKRMQD
LNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAG
PAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGAG
GPGLCTCAVCKFPHLVPASLGLAAVQAQFSK

Sequence length

271

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Non Small Cell Lung	Associate	17388669	★★★★★ ★☆☆☆☆ Found in Text Mining only
Creutzfeldt Jakob Syndrome	Associate	30009661	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Associate	30989628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	22380883, 32999376	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	31882550	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	31882550	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Injuries	Associate	26497545	★★★★★ ★☆☆☆☆ Found in Text Mining only

OLIG1 (oligodendrocyte transcription factor 1)