ACSM1 (acyl-CoA synthetase medium chain family member 1)

Gene

• Entrez ID: 116285
• Gene name: Acyl-CoA synthetase medium chain family member 1
• Gene symbol: ACSM1
• Synonyms (NCBI Gene): BUCS1, MACS1
• Chromosome: 16
• Chromosome location: 16p12.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016971	hsa-miR-335-5p	Microarray	18185580
MIRT2443089	hsa-miR-1252	CLIP-seq
MIRT2443090	hsa-miR-2681	CLIP-seq
MIRT2443091	hsa-miR-3673	CLIP-seq
MIRT2443092	hsa-miR-570	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001676	Process	Long-chain fatty acid metabolic process	IEA
GO:0004321	Function	Fatty-acyl-CoA synthase activity	IBA
GO:0004467	Function	Long-chain fatty acid-CoA ligase activity	IDA	11470804
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IBA
GO:0005759	Component	Mitochondrial matrix	IDA	11470804
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006633	Process	Fatty acid biosynthetic process	IBA
GO:0006633	Process	Fatty acid biosynthetic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	IBA
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0015645	Function	Fatty acid ligase activity	IBA
GO:0015645	Function	Fatty acid ligase activity	IEA
GO:0015980	Process	Energy derivation by oxidation of organic compounds	NAS	11470804
GO:0016405	Function	CoA-ligase activity	IEA
GO:0016405	Function	CoA-ligase activity	TAS
GO:0016874	Function	Ligase activity	IEA
GO:0016878	Function	Acid-thiol ligase activity	IEA
GO:0018858	Function	Benzoate-CoA ligase activity	IDA	10434065
GO:0018858	Function	Benzoate-CoA ligase activity	IEA
GO:0018874	Process	Benzoate metabolic process	NAS	11470804
GO:0019395	Process	Fatty acid oxidation	NAS	11470804
GO:0019605	Process	Butyrate metabolic process	NAS	11470804
GO:0031956	Function	Medium-chain fatty acid-CoA ligase activity	IDA	10434065, 11470804
GO:0031956	Function	Medium-chain fatty acid-CoA ligase activity	IEA
GO:0042632	Process	Cholesterol homeostasis	NAS	15361761
GO:0046872	Function	Metal ion binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0072562	Component	Blood microparticle	HDA	22516433
GO:0102391	Function	Decanoate-CoA ligase activity	IDA	10434065
GO:0102391	Function	Decanoate-CoA ligase activity	IEA

Other IDs

• MIM: 614357
• HGNC: 18049
• e!Ensembl: ENSG00000166743

Protein

• UniProt ID: Q08AH1
• Protein name: Acyl-coenzyme A synthetase ACSM1, mitochondrial (EC 6.2.1.2) (Acyl-CoA synthetase medium-chain family member 1) (Benzoate--CoA ligase) (EC 6.2.1.25) (Butyrate--CoA ligase 1) (Butyryl-coenzyme A synthetase 1) (Lipoate-activating enzyme) (Middle-chain acyl-
• Protein function: Catalyzes the activation of fatty acids by CoA to produce an acyl-CoA, the first step in fatty acid metabolism (PubMed:10434065). Capable of activating medium-chain fatty acids (e.g. butyric (C4) to decanoic (C10) acids), and certain carboxylate
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00501	AMP-binding	62 → 475	AMP-binding enzyme	Family
  PF13193	AMP-binding_C	483 → 563	AMP-binding enzyme C-terminal domain	Domain

• Sequence:

  MQWLMRFRTLWGIHKSFHNIHPAPSQLRCRSLSEFGAPRWNDYEVPEEFNFASYVLDYWA
  QKEKEGKRGPNPAFWWVNGQGDEVKWSFREMGDLTRRVANVFTQTCGLQQGDHLALMLPR
  VPEWWLVAVGCMRTGIIFIPATILLKAKDILYRLQLSKAKGIVTIDALASEVDSIASQCP
  SLKTKLLVSDHSREGWLDFRSLVKSASPEHTCVKSKTLDPMVIFFTSGTTGFPKMAKHSH
  GLALQPSFPGSRKLRSLKTSDVSWCLSDSGWIVATIWTLVEPWTAGCTVFIHHLPQFDTK
  VIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
  LLLYENYGQSETGLICATYWGMKIKPGFMGKATPPYDVQVIDDKGSILPPNTEGNIGIRI
  KPVRPVSLFMCYEGDPEKTAKVECGDFYNTGDRGKMDEEGYICFLGRSDDIINASGYRIG
  PAEVESALVEHPAVAESAVVGSPDPIRGEVVKAFIVLTPQFLSHDKDQLTKELQQHVKSV
  TAPYKYPRKVEFVSELPKTITGKIERKELRKKETGQM

• Sequence length: 577

Pathways

KEGG:

Butanoate metabolism
Lipoic acid metabolism
Metabolic pathways

Reactome:

Conjugation of benzoate with glycine
Conjugation of phenylacetate with glutamine