LRRC3B (leucine rich repeat containing 3B)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 116135
Gene name Leucine rich repeat containing 3B
Gene symbol LRRC3B
Synonyms (NCBI Gene)
LRP15
Chromosome 3
Chromosome location 3p24.1
Summary The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hype
miRNA miRNA information provided by mirtarbase database.
5
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (5)
miRTarBase ID miRNA Experiments Reference
MIRT1119593 hsa-miR-105 CLIP-seq
MIRT1119594 hsa-miR-1193 CLIP-seq
MIRT1119595 hsa-miR-3671 CLIP-seq
MIRT1119596 hsa-miR-561 CLIP-seq
MIRT1119597 hsa-miR-607 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (4)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IBA
GO:0016020 Component Membrane IEA
GO:0038023 Function Signaling receptor activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
618996 28105 ENSG00000179796
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96PB8
Protein name Leucine-rich repeat-containing protein 3B (Leucine-rich repeat protein 15)
PDB 5EMA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 33 → 63 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 64 → 114 Leucine rich repeat Repeat
PF00560 LRR_1 114 → 136 Leucine Rich Repeat Repeat
Sequence 
MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPR
DLPPETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDL
SDNRIQSVHKNAFNNLKARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEH
AGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLK
SLPSRQKKADEPDDISTVV
Sequence length 259
Interactions View interactions