Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
116135
Gene name Gene Name - the full gene name approved by the HGNC.
Leucine rich repeat containing 3B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LRRC3B
Synonyms (NCBI Gene) Gene synonyms aliases
LRP15
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p24.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a tumor suppressor, with lowered expression levels found in gastric, renal, colorectal, lung, and breast cancer tissues. The promoter of this gene is frequently hypermethylated in these cancer tissues, although the hype
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1119593 hsa-miR-105 CLIP-seq
MIRT1119594 hsa-miR-1193 CLIP-seq
MIRT1119595 hsa-miR-3671 CLIP-seq
MIRT1119596 hsa-miR-561 CLIP-seq
MIRT1119597 hsa-miR-607 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005615 Component Extracellular space IBA 21873635
GO:0016021 Component Integral component of membrane IEA
GO:0031012 Component Extracellular matrix IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618996 28105 ENSG00000179796
Protein
UniProt ID Q96PB8
Protein name Leucine-rich repeat-containing protein 3B (Leucine-rich repeat protein 15)
PDB 5EMA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 33 63 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 64 114 Leucine rich repeat Repeat
PF00560 LRR_1 114 136 Leucine Rich Repeat Repeat
Sequence
MNLVDLWLTRSLSMCLLLQSFVLMILCFHSASMCPKGCLCSSSGGLNVTCSNANLKEIPR
DLP
PETVLLYLDSNQITSIPNEIFKDLHQLRVLNLSKNGIEFIDEHAFKGVAETLQTLDL
SDNRIQSVHKNAFNNL
KARARIANNPWHCDCTLQQVLRSMASNHETAHNVICKTSVLDEH
AGRPFLNAANDADLCNLPKKTTDYAMLVTMFGWFTMVISYVVYYVRQNQEDARRHLEYLK
SLPSRQKKADEPDDISTVV
Sequence length 259
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
29915430
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
29915430
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
18815942
Colorectal neoplasms Colorectal Neoplasms rs28929483, rs63751108, rs28929484, rs63749831, rs63750047, rs63751207, rs63749811, rs1553350126, rs63750875, rs63750955, rs587776706, rs63750871, rs587776715, rs63751466, rs63750049
View all (1682 more)
18815942
Unknown
Disease term Disease name Evidence References Source
Asthma Asthma GWAS
Ovarian cancer Ovarian cancer Conditional KD of IL6 in the OCCA xenograft model delays tumor growth GWAS, CBGDA
Dementia Dementia GWAS
Oligodendroglioma Oligodendroglioma GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 22491060
Breast Neoplasms Associate 36798137
Carcinoma Non Small Cell Lung Inhibit 26276358
Carcinoma Non Small Cell Lung Associate 30185536, 36798137
Carcinoma Renal Cell Associate 24977159
Carcinoma Squamous Cell Associate 22491060
Kidney Neoplasms Associate 27725787
Lung Neoplasms Inhibit 26276358
Lymphatic Metastasis Inhibit 26276358
Myocardial Infarction Associate 28408707