Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
116071
Gene name Gene Name - the full gene name approved by the HGNC.
Basic leucine zipper ATF-like transcription factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BATF2
Synonyms (NCBI Gene) Gene synonyms aliases
SARI
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017734 hsa-miR-335-5p Microarray 18185580
MIRT019820 hsa-miR-375 Microarray 20215506
MIRT023328 hsa-miR-122-5p Microarray 17612493
MIRT736956 hsa-miR-765 Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry 32166887
MIRT755973 hsa-miR-5189-3p Luciferase reporter assay, Western blotting, qRT-PCR 35246006
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
614983 25163 ENSG00000168062
Protein
UniProt ID Q8N1L9
Protein name Basic leucine zipper transcriptional factor ATF-like 2 (B-ATF-2) (Suppressor of AP-1 regulated by IFN) (SARI)
Protein function AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system. Following infection, participates in the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 15 72 bZIP transcription factor Coiled-coil
Sequence
MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALR
KEIQSLQAELAW
WSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQ
LELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASH
TGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREH
KPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Sequence length 274
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  PD-L1 expression and PD-1 checkpoint pathway in cancer  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Autism Spectrum Disorder Associate 36077244
Breast Neoplasms Associate 34565331
Carcinoma Non Small Cell Lung Inhibit 24133583
Epilepsy Associate 36672163
Fever Associate 27734027
Hypersensitivity Immediate Associate 36672163
Inflammation Stimulate 36077244
Inflammation Associate 36672163
Influenza Human Associate 34367124
Intellectual Disability Associate 36672163