Gene Gene information from NCBI Gene database.
Entrez ID 116071
Gene name Basic leucine zipper ATF-like transcription factor 2
Gene symbol BATF2
Synonyms (NCBI Gene)
SARI
Chromosome 11
Chromosome location 11q13.1
miRNA miRNA information provided by mirtarbase database.
215
miRTarBase ID miRNA Experiments Reference
MIRT017734 hsa-miR-335-5p Microarray 18185580
MIRT019820 hsa-miR-375 Microarray 20215506
MIRT023328 hsa-miR-122-5p Microarray 17612493
MIRT736956 hsa-miR-765 Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry 32166887
MIRT755973 hsa-miR-5189-3p Luciferase reporter assayWestern blottingqRT-PCR 35246006
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
21
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
614983 25163 ENSG00000168062
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N1L9
Protein name Basic leucine zipper transcriptional factor ATF-like 2 (B-ATF-2) (Suppressor of AP-1 regulated by IFN) (SARI)
Protein function AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system. Following infection, participates in the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 15 72 bZIP transcription factor Coiled-coil
Sequence
MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALR
KEIQSLQAELAW
WSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQ
LELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASH
TGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREH
KPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF
Sequence length 274
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  PD-L1 expression and PD-1 checkpoint pathway in cancer