Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
116039
Gene name Gene Name - the full gene name approved by the HGNC.
Odd-skipped related transciption factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
OSR2
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.2
Summary Summary of gene provided in NCBI Entrez Gene.
OSR2 is a mammalian homolog of the Drosophila odd-skipped family of transcription factors (Lan et al., 2004 [PubMed 15175245]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT1206894 hsa-miR-103a CLIP-seq
MIRT1206895 hsa-miR-107 CLIP-seq
MIRT1206896 hsa-miR-1184 CLIP-seq
MIRT1206897 hsa-miR-1205 CLIP-seq
MIRT1206898 hsa-miR-1244 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding ISS
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
611297 15830 ENSG00000164920
Protein
UniProt ID Q8N2R0
Protein name Protein odd-skipped-related 2
Protein function May be involved in the development of the mandibular molar tooth germ at the bud stage.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 172 194 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 200 222 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 228 250 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 256 278 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 284 306 Zinc finger, C2H2 type Domain
Sequence
MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPN
VHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFAN
LAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRH
FTKSYNLLIHERTH
TDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQS
RTLAVHKTLH
MQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLR
RHSLTH
TPRQDF
Sequence length 312
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Endometriosis Endometriosis 20864642 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Endometrial Neoplasms Associate 32555395
Ischemia Associate 37429230
Non Muscle Invasive Bladder Neoplasms Associate 33711044
Stomach Neoplasms Associate 27143812