Gene Gene information from NCBI Gene database.
Entrez ID 116039
Gene name Odd-skipped related transciption factor 2
Gene symbol OSR2
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8q22.2
Summary OSR2 is a mammalian homolog of the Drosophila odd-skipped family of transcription factors (Lan et al., 2004 [PubMed 15175245]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
153
miRTarBase ID miRNA Experiments Reference
MIRT1206894 hsa-miR-103a CLIP-seq
MIRT1206895 hsa-miR-107 CLIP-seq
MIRT1206896 hsa-miR-1184 CLIP-seq
MIRT1206897 hsa-miR-1205 CLIP-seq
MIRT1206898 hsa-miR-1244 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
74
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611297 15830 ENSG00000164920
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N2R0
Protein name Protein odd-skipped-related 2
Protein function May be involved in the development of the mandibular molar tooth germ at the bud stage.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 172 194 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 200 222 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 228 250 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 256 278 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 284 306 Zinc finger, C2H2 type Domain
Sequence
MGSKALPAPIPLHPSLQLTNYSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPN
VHEITRSTITEMAAAQGLVDARFPFPALPFTTHLFHPKQGAIAHVLPALHKDRPRFDFAN
LAVAATQEDPPKMGDLSKLSPGLGSPISGLSKLTPDRKPSRGRLPSKTKKEFICKFCGRH
FTKSYNLLIHERTH
TDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQS
RTLAVHKTLH
MQESPHKCPTCGRTFNQRSNLKTHLLTHTDIKPYSCEQCGKVFRRNCDLR
RHSLTH
TPRQDF
Sequence length 312
Interactions View interactions