Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	116
Gene name Gene Name - the full gene name approved by the HGNC.	Adenylate cyclase activating polypeptide 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADCYAP1
Synonyms (NCBI Gene) Gene synonyms aliases	PACAP
Chromosome Chromosome number	18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	18p11.32
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target ge

Show/Hide all(215)

miRTarBase ID	miRNA	Experiments	Reference
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508279	hsa-miR-6074	HITS-CLIP	21572407
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT508278	hsa-miR-6083	HITS-CLIP	21572407
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508279	hsa-miR-6074	HITS-CLIP	23313552
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508279	hsa-miR-6074	HITS-CLIP	23313552
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT639088	hsa-miR-4803	HITS-CLIP	23824327
MIRT639087	hsa-miR-1323	HITS-CLIP	23824327
MIRT639086	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT639085	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT639084	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT639083	hsa-miR-607	HITS-CLIP	23824327
MIRT639082	hsa-miR-1305	HITS-CLIP	23824327
MIRT639081	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT549625	hsa-miR-1284	PAR-CLIP	20371350
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508278	hsa-miR-6083	PAR-CLIP	20371350
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508279	hsa-miR-6074	PAR-CLIP	21572407
MIRT549625	hsa-miR-1284	PAR-CLIP	21572407
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508278	hsa-miR-6083	PAR-CLIP	21572407
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508279	hsa-miR-6074	PAR-CLIP	23446348
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508278	hsa-miR-6083	PAR-CLIP	23446348
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT712596	hsa-miR-8066	HITS-CLIP	19536157
MIRT712595	hsa-miR-221-5p	HITS-CLIP	19536157
MIRT712594	hsa-miR-8073	HITS-CLIP	19536157
MIRT712593	hsa-miR-3653-5p	HITS-CLIP	19536157
MIRT712592	hsa-miR-1976	HITS-CLIP	19536157
MIRT712591	hsa-miR-6868-5p	HITS-CLIP	19536157
MIRT712590	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT712589	hsa-miR-885-3p	HITS-CLIP	19536157
MIRT712588	hsa-miR-7641	HITS-CLIP	19536157
MIRT712587	hsa-miR-106a-3p	HITS-CLIP	19536157
MIRT712586	hsa-miR-450b-5p	HITS-CLIP	19536157
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT508279	hsa-miR-6074	HITS-CLIP	21572407
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT508278	hsa-miR-6083	HITS-CLIP	21572407
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508279	hsa-miR-6074	HITS-CLIP	23313552
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23313552
MIRT508279	hsa-miR-6074	HITS-CLIP	23313552
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT639088	hsa-miR-4803	HITS-CLIP	23824327
MIRT639087	hsa-miR-1323	HITS-CLIP	23824327
MIRT639086	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT639085	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT639084	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT639083	hsa-miR-607	HITS-CLIP	23824327
MIRT639082	hsa-miR-1305	HITS-CLIP	23824327
MIRT639081	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT508279	hsa-miR-6074	HITS-CLIP	23824327
MIRT508277	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT508278	hsa-miR-6083	HITS-CLIP	23824327
MIRT508276	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT549625	hsa-miR-1284	PAR-CLIP	20371350
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT508278	hsa-miR-6083	PAR-CLIP	20371350
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT508279	hsa-miR-6074	PAR-CLIP	21572407
MIRT549625	hsa-miR-1284	PAR-CLIP	21572407
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT508278	hsa-miR-6083	PAR-CLIP	21572407
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT508280	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT508279	hsa-miR-6074	PAR-CLIP	23446348
MIRT508277	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT508278	hsa-miR-6083	PAR-CLIP	23446348
MIRT508276	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT768341	hsa-miR-132	CLIP-seq
MIRT768342	hsa-miR-212	CLIP-seq
MIRT768343	hsa-miR-329	CLIP-seq
MIRT768344	hsa-miR-362-3p	CLIP-seq
MIRT768345	hsa-miR-3941	CLIP-seq
MIRT768346	hsa-miR-3973	CLIP-seq
MIRT768347	hsa-miR-410	CLIP-seq
MIRT768348	hsa-miR-4659a-3p	CLIP-seq
MIRT768349	hsa-miR-4659b-3p	CLIP-seq
MIRT768350	hsa-miR-466	CLIP-seq
MIRT768351	hsa-miR-4672	CLIP-seq
MIRT768352	hsa-miR-520g	CLIP-seq
MIRT768353	hsa-miR-520h	CLIP-seq
MIRT768354	hsa-miR-603	CLIP-seq
MIRT768355	hsa-miR-1249	CLIP-seq
MIRT768356	hsa-miR-1302	CLIP-seq
MIRT768357	hsa-miR-3122	CLIP-seq
MIRT768358	hsa-miR-3199	CLIP-seq
MIRT768359	hsa-miR-3619-3p	CLIP-seq
MIRT768360	hsa-miR-3686	CLIP-seq
MIRT768361	hsa-miR-3913-5p	CLIP-seq
MIRT768362	hsa-miR-4298	CLIP-seq
MIRT768363	hsa-miR-4326	CLIP-seq
MIRT768364	hsa-miR-4436a	CLIP-seq
MIRT768365	hsa-miR-4632	CLIP-seq
MIRT768366	hsa-miR-4652-3p	CLIP-seq
MIRT768367	hsa-miR-582-5p	CLIP-seq
MIRT1926651	hsa-miR-1261	CLIP-seq
MIRT768346	hsa-miR-3973	CLIP-seq
MIRT2167600	hsa-miR-1182	CLIP-seq
MIRT768355	hsa-miR-1249	CLIP-seq
MIRT2167601	hsa-miR-1266	CLIP-seq
MIRT2167602	hsa-miR-1267	CLIP-seq
MIRT2167603	hsa-miR-1912	CLIP-seq
MIRT2167604	hsa-miR-3130-5p	CLIP-seq
MIRT2167605	hsa-miR-323b-3p	CLIP-seq
MIRT2167606	hsa-miR-324-5p	CLIP-seq
MIRT2167607	hsa-miR-3664-3p	CLIP-seq
MIRT768360	hsa-miR-3686	CLIP-seq
MIRT768363	hsa-miR-4326	CLIP-seq
MIRT2167608	hsa-miR-4482	CLIP-seq
MIRT2167609	hsa-miR-4518	CLIP-seq
MIRT768366	hsa-miR-4652-3p	CLIP-seq
MIRT2167610	hsa-miR-4738-5p	CLIP-seq
MIRT768367	hsa-miR-582-5p	CLIP-seq
MIRT2426021	hsa-miR-1283	CLIP-seq

Show/Hide all(65)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001541	Process	Ovarian follicle development	IEA
GO:0001662	Process	Behavioral fear response	IEA
GO:0001821	Process	Histamine secretion	IEA
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	IEA
GO:0002878	Process	Negative regulation of acute inflammatory response to non-antigenic stimulus	IEA
GO:0005102	Function	Signaling receptor binding	IPI
GO:0005184	Function	Neuropeptide hormone activity	IBA	21873635
GO:0005184	Function	Neuropeptide hormone activity	IDA	23800469
GO:0005515	Function	Protein binding	IPI	17470806, 25451228, 32814053
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	9603988
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	1730060
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007218	Process	Neuropeptide signaling pathway	IDA	23800469
GO:0007267	Process	Cell-cell signaling	TAS	2302217
GO:0007565	Process	Female pregnancy	TAS	10698193
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IDA	11175907
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0010656	Process	Negative regulation of muscle cell apoptotic process	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0016521	Function	Pituitary adenylate cyclase activating polypeptide activity	IBA	21873635
GO:0016521	Function	Pituitary adenylate cyclase activating polypeptide activity	IDA	9603988
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019933	Process	CAMP-mediated signaling	IMP	23800469
GO:0021983	Process	Pituitary gland development	IEA
GO:0030073	Process	Insulin secretion	ISS
GO:0031175	Process	Neuron projection development	IBA	21873635
GO:0031175	Process	Neuron projection development	IDA	23800469
GO:0031858	Function	Pituitary adenylate cyclase-activating polypeptide receptor binding	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032880	Process	Regulation of protein localization	IBA	21873635
GO:0032880	Process	Regulation of protein localization	IDA	9603988
GO:0034260	Process	Negative regulation of GTPase activity	IEA
GO:0042594	Process	Response to starvation	IEA
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0043195	Component	Terminal bouton	IEA
GO:0043204	Component	Perikaryon	IBA	21873635
GO:0043267	Process	Negative regulation of potassium ion transport	IEA
GO:0043547	Process	Positive regulation of GTPase activity	IBA	21873635
GO:0043547	Process	Positive regulation of GTPase activity	IDA	23800469
GO:0043950	Process	Positive regulation of cAMP-mediated signaling	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045860	Process	Positive regulation of protein kinase activity	IBA	21873635
GO:0045860	Process	Positive regulation of protein kinase activity	IDA	23800469
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23800469
GO:0046034	Process	ATP metabolic process	IEA
GO:0051428	Function	Peptide hormone receptor binding	IBA	21873635
GO:0051428	Function	Peptide hormone receptor binding	IDA	11175907
GO:0051428	Function	Peptide hormone receptor binding	IPI	17470806
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060124	Process	Positive regulation of growth hormone secretion	ISS
GO:0060253	Process	Negative regulation of glial cell proliferation	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA	21873635
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	23800469
GO:0070445	Process	Regulation of oligodendrocyte progenitor proliferation	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IEA
GO:0071651	Process	Positive regulation of chemokine (C-C motif) ligand 5 production	IDA	24696163
GO:0090274	Process	Positive regulation of somatostatin secretion	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	12239106

MIM	HGNC	e!Ensembl
102980	241	ENSG00000141433

Protein

UniProt ID

P18509

Protein name

Pituitary adenylate cyclase-activating polypeptide (PACAP) [Cleaved into: PACAP-related peptide (PRP-48); Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27) (PACAP27); Pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38) (PACAP38

Protein function

PACAP is a neuropeptide involved in diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VIPR1), VIP receptor 2 (VIPR2), and PACAP type I receptor (ADCYAP1R1) (P

PDB

1GEA , 2D2P , 2JOD , 6LPB , 6M1I , 6P9Y , 6VN7 , 7VQX , 7WBJ , 8E3X , 8E3Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00123	Hormone_2	83 → 110	Peptide hormone	Family
PF00123	Hormone_2	132 → 159	Peptide hormone	Family

Sequence

MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG
AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG
AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL

Sequence length

176

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Circadian entrainment Insulin secretion Renin secretion		G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Cardiomyopathy	Cardiomyopathies, Primary, Cardiomyopathies	rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377 View all (900 more)	20378996
Esophagus neoplasm	Squamous cell carcinoma of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	21517111
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	23268987, 20144662, 24586556, 22843252
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061 View all (179 more)	29673861

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder	19914336, 25014004, 20144662, 22178610	ClinVar
Restless Legs Syndrome	Restless Legs Syndrome		GWAS

Show/Hide Text Mining Associations (52)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	24719484, 37226771
Anxiety	Associate	29249830, 31910434
Anxiety Disorders	Associate	31910434
Bipolar Disorder	Associate	37226771
Blood Platelet Disorders	Associate	25758343
Breast Neoplasms	Associate	16019382
Carcinoma Non Small Cell Lung	Associate	30273693
Carcinoma Renal Cell	Associate	32628820
Carcinoma Squamous Cell	Associate	32218699
Colorectal Neoplasms	Associate	35880088
Dementia	Inhibit	24719484
Depressive Disorder	Associate	37226771
Depressive Disorder Major	Associate	37226771
Diabetes Gestational	Associate	31485258
Diabetes Mellitus Type 2	Associate	28761062
Diffuse Intrinsic Pontine Glioma	Associate	39972389
Endometrial Neoplasms	Associate	24623538, 31902687
Esotropia	Associate	21738391
general anxiety disorder	Associate	31910434
Glucosephosphate Dehydrogenase Deficiency	Associate	25677060
Inflammation	Inhibit	17962362, 39201536
Intellectual Disability	Associate	27900577
Leukemia	Associate	8384124
Lung Diseases Interstitial	Associate	23897225
Lung Neoplasms	Associate	11193832, 22581436, 30273693
Mental Disorders	Associate	31910434
Mood Disorders	Associate	37226771
Multiple Sclerosis	Associate	39201536
Neoplasms	Stimulate	14742913
Neoplasms	Associate	24515671, 26768780, 37830980, 39972389
Nephrosis congenital	Associate	25758343
Nephrotic Syndrome	Associate	25758343
Neuroblastoma	Associate	1321043, 7913440
Neuroendocrine Tumors	Associate	19701709
Nose Diseases	Associate	35628331
Pain	Associate	17962362
Pancreatitis Chronic	Associate	17962362
Panic Disorder	Associate	29249830
Paraganglioma	Associate	12067490
Pituitary Neoplasms	Associate	10595920, 9846969
Prostatic Neoplasms	Associate	12839880
Psychotic Disorders	Associate	37226771
Squamous Cell Carcinoma of Head and Neck	Associate	25612142
Squamous Intraepithelial Lesions	Associate	26552048
Squamous Intraepithelial Lesions	Stimulate	26768780
Strabismus	Associate	21738391
Stress Disorders Post Traumatic	Associate	24516127
Tarlov Cysts	Stimulate	37830980
Thrombocytosis	Associate	25758343
Thrombosis	Associate	25758343
Trauma and Stressor Related Disorders	Associate	37226771
Uterine Cervical Neoplasms	Associate	26552048, 26768780, 37830980

ADCYAP1 (adenylate cyclase activating polypeptide 1)