Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	115584
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 5 member 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC5A11
Synonyms (NCBI Gene) Gene synonyms aliases	KST1, RKST1, SGLT6, SMIT2
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16p12.1
Summary Summary of gene provided in NCBI Entrez Gene.	Cotransporters, such as SLC5A11, represent a major class of proteins that make use of ion gradients to drive active transport for the cellular accumulation of nutrients, neurotransmitters, osmolytes, and ions Roll et al. (2002) [PubMed 12039040].[supplied

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2332165	hsa-miR-4694-3p	CLIP-seq
MIRT2332166	hsa-miR-4709-3p	CLIP-seq

Show/Hide all(23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005365	Function	Myo-inositol transmembrane transporter activity	IDA	19032932
GO:0005365	Function	Myo-inositol transmembrane transporter activity	IEA
GO:0005412	Function	D-glucose:sodium symporter activity	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008645	Process	Hexose transmembrane transport	IEA
GO:0015166	Function	Polyol transmembrane transporter activity	TAS
GO:0015293	Function	Symporter activity	IEA
GO:0015791	Process	Polyol transmembrane transport	IEA
GO:0015798	Process	Myo-inositol transport	IDA	19032932
GO:0015798	Process	Myo-inositol transport	TAS
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0034219	Process	Carbohydrate transmembrane transport	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
610238	23091	ENSG00000158865

Protein

UniProt ID

Q8WWX8

Protein name

Sodium/myo-inositol cotransporter 2 (Na(+)/myo-inositol cotransporter 2) (Sodium-dependent glucose cotransporter) (Sodium/glucose cotransporter KST1) (Sodium/myo-inositol transporter 2) (SMIT2) (Solute carrier family 5 member 11)

Protein function

Involved in the sodium-dependent cotransport of myo-inositol (MI) with a Na(+):MI stoichiometry of 2:1 (PubMed:15172003, PubMed:19032932). Exclusively responsible for apical MI transport and absorption in intestine (By similarity). Can also tran

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00474	SSF	58 → 487	Sodium:solute symporter family	Family

Tissue specificity

TISSUE SPECIFICITY: Highest expression in heart, skeletal muscle, kidney, liver and placenta. Weaker expression in brain, colon, spleen, lung and peripheral blood leukocytes. {ECO:0000269|PubMed:12039040}.

Sequence

MESGTSSPQPPQLDPLDAFPQKGLEPGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFL
AGGDMVWWPVGASLFASNVGSGHFIGLAGSGAATGISVSAYELNGLFSVLMLAWIFLPIY
IAGQVTTMPEYLRKRFGGIRIPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHLDLYLA
IVGLLAITAVYTVAGGLAAVIYTDALQTLIMLIGALTLMGYSFAAVGGMEGLKEKYFLAL
ASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVLFGMSIPSLWYWCTDQVIVQRTLAAK
NLSHAKGGALMAAYLKVLPLFIMVFPGMVSRILFPDQVACADPEICQKICSNPSGCSDIA
YPKLVLELLPTGLRGLMMAVMVAALMSSLTSIFNSASTIFTMDLWNHLRPRASEKELMIV
GRVFVLLLVLVSILWIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRTNEKGA
FWGLISGLLLGLVRLVLDFIYVQPRCDQPDERPVLVKSIHYLYFSMILSTVTLITVSTVS
WFTEPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQE
NTSKTHSCDMTPKQSKVVKAILWLCGIQEKGKEELPARAEAIIVSLEENPLVKTLLDVNL
IFCVSCAIFIWGYFA

Sequence length

675

Interactions

View interactions

	Reactome
			Inositol transporters

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Gout	Gout	N/A	N/A	GWAS

Show/Hide Text Mining Associations (5)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Cerebral Infarction	Associate	26352407
Hypertension Pulmonary	Associate	26352407
Obesity	Associate	34207686
Renal Insufficiency Chronic	Associate	26352407
Thyroid Carcinoma Anaplastic	Associate	26680454

SLC5A11 (solute carrier family 5 member 11)