Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1154
Gene name Gene Name - the full gene name approved by the HGNC.
Cytokine inducible SH2 containing protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CISH
Synonyms (NCBI Gene) Gene synonyms aliases
BACTS2, CIS, CIS-1, G18, SOCS
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029522 hsa-miR-26b-5p Microarray 19088304
MIRT054146 hsa-miR-92a-1-5p Microarray, qRT-PCR 22660396
MIRT437917 hsa-miR-150-5p Luciferase reporter assay, Western blot 23723424
MIRT437917 hsa-miR-150-5p Luciferase reporter assay, Western blotting, qRT-PCR 34027272
MIRT893792 hsa-miR-125a-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
STAT3 Activation 14630083
STAT6 Unknown 18342537
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth NAS 9465889
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 16273093, 24658140, 31980649, 32814053
GO:0005575 Component Cellular_component ND
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602441 1984 ENSG00000114737
Protein
UniProt ID Q9NSE2
Protein name Cytokine-inducible SH2-containing protein (CIS) (CIS-1) (Protein G18) (Suppressor of cytokine signaling) (SOCS)
Protein function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolact
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 82 163 SH2 domain Domain
PF07525 SOCS_box 221 254 SOCS box Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in various epithelial tissues. Abundantly expressed in liver and kidney, and to a lesser extent in lung. The tissue distribution of isoforms 1 and 1B is distinct. {ECO:0000269|PubMed:11032736}.
Sequence
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHY
VASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQY
PFQL
Sequence length 258
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  JAK-STAT signaling pathway
Prolactin signaling pathway
  Interleukin-7 signaling
Neddylation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Dermatitis Dermatitis, Allergic Contact rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174 16033404
Associations from Text Mining
Disease Name Relationship Type References
Alveolar Bone Loss Inhibit 19026878
Alzheimer Disease Associate 25286386
Asthma Associate 30197185
Breast Neoplasms Associate 12888825, 16446704, 18254957, 25104439, 26625783, 40003884
Carcinoma Hepatocellular Inhibit 39307915
Carcinoma Intraductal Noninfiltrating Associate 20712900
Colorectal Neoplasms Associate 22121102, 25330801
Communicable Diseases Associate 24964072
Diabetes Mellitus Type 1 Associate 30942443
Glioblastoma Associate 40071076