Gene Gene information from NCBI Gene database.
Entrez ID 1154
Gene name Cytokine inducible SH2 containing protein
Gene symbol CISH
Synonyms (NCBI Gene)
BACTS2CISCIS-1G18SOCS
Chromosome 3
Chromosome location 3p21.2
Summary The protein encoded by this gene contains a SH2 domain and a SOCS box domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family
miRNA miRNA information provided by mirtarbase database.
277
miRTarBase ID miRNA Experiments Reference
MIRT029522 hsa-miR-26b-5p Microarray 19088304
MIRT054146 hsa-miR-92a-1-5p MicroarrayqRT-PCR 22660396
MIRT437917 hsa-miR-150-5p Luciferase reporter assayWestern blot 23723424
MIRT437917 hsa-miR-150-5p Luciferase reporter assayWestern blottingqRT-PCR 34027272
MIRT893792 hsa-miR-125a-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Transcription factor Regulation Reference
STAT3 Activation 14630083
STAT6 Unknown 18342537
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0001558 Process Regulation of cell growth NAS 9465889
GO:0001960 Process Negative regulation of cytokine-mediated signaling pathway IEA
GO:0005126 Function Cytokine receptor binding IBA
GO:0005515 Function Protein binding IPI 16273093, 24658140, 31980649, 32814053
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602441 1984 ENSG00000114737
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NSE2
Protein name Cytokine-inducible SH2-containing protein (CIS) (CIS-1) (Protein G18) (Suppressor of cytokine signaling) (SOCS)
Protein function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolact
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00017 SH2 82 163 SH2 domain Domain
PF07525 SOCS_box 221 254 SOCS box Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in various epithelial tissues. Abundantly expressed in liver and kidney, and to a lesser extent in lung. The tissue distribution of isoforms 1 and 1B is distinct. {ECO:0000269|PubMed:11032736}.
Sequence
MVLCVQGPRPLLAVERTGQRPLWAPSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHY
VASCTADTRSDSPDPAP
TPALPMPKEDAPSDPALPAPPPATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDC
LPLPRRMADYLRQY
PFQL
Sequence length 258
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  JAK-STAT signaling pathway
Prolactin signaling pathway
  Interleukin-7 signaling
Neddylation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
6
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Bacteremia, susceptibility to, 2 risk factor rs414171 RCV000023195
CISH-related disorder Likely benign rs2471650128, rs199816251, rs148162012 RCV003898982
RCV003924147
RCV003922884
Malaria, susceptibility to risk factor rs414171 RCV000007508
Tuberculosis, susceptibility to risk factor rs414171 RCV000007507
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alveolar Bone Loss Inhibit 19026878
Alzheimer Disease Associate 25286386
Asthma Associate 30197185
Breast Neoplasms Associate 12888825, 16446704, 18254957, 25104439, 26625783, 40003884
Carcinoma Hepatocellular Inhibit 39307915
Carcinoma Intraductal Noninfiltrating Associate 20712900
Colorectal Neoplasms Associate 22121102, 25330801
Communicable Diseases Associate 24964072
Diabetes Mellitus Type 1 Associate 30942443
Glioblastoma Associate 40071076