Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1153
Gene name	Cold inducible RNA binding protein
Gene symbol	CIRBP
Synonyms (NCBI Gene)	CIRP
Chromosome	19
Chromosome location	19p13.3

145

Show/Hide all (145)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028434	hsa-miR-30a-5p	Proteomics	18668040
MIRT030423	hsa-miR-24-3p	Microarray	19748357
MIRT893552	hsa-miR-145	CLIP-seq
MIRT893553	hsa-miR-188-3p	CLIP-seq
MIRT893554	hsa-miR-3148	CLIP-seq
MIRT893555	hsa-miR-3155	CLIP-seq
MIRT893556	hsa-miR-3155b	CLIP-seq
MIRT893557	hsa-miR-3157-5p	CLIP-seq
MIRT893558	hsa-miR-3202	CLIP-seq
MIRT893559	hsa-miR-325	CLIP-seq
MIRT893560	hsa-miR-338-5p	CLIP-seq
MIRT893561	hsa-miR-3610	CLIP-seq
MIRT893562	hsa-miR-377	CLIP-seq
MIRT893563	hsa-miR-383	CLIP-seq
MIRT893564	hsa-miR-3978	CLIP-seq
MIRT893565	hsa-miR-4252	CLIP-seq
MIRT893566	hsa-miR-4468	CLIP-seq
MIRT893567	hsa-miR-4476	CLIP-seq
MIRT893568	hsa-miR-4505	CLIP-seq
MIRT893569	hsa-miR-4529-5p	CLIP-seq
MIRT893570	hsa-miR-4533	CLIP-seq
MIRT893571	hsa-miR-4534	CLIP-seq
MIRT893572	hsa-miR-4643	CLIP-seq
MIRT893573	hsa-miR-466	CLIP-seq
MIRT893574	hsa-miR-4691-3p	CLIP-seq
MIRT893575	hsa-miR-4699-3p	CLIP-seq
MIRT893576	hsa-miR-4712-5p	CLIP-seq
MIRT893577	hsa-miR-4789-3p	CLIP-seq
MIRT893578	hsa-miR-4796-3p	CLIP-seq
MIRT893579	hsa-miR-484	CLIP-seq
MIRT893580	hsa-miR-514	CLIP-seq
MIRT893581	hsa-miR-514b-3p	CLIP-seq
MIRT893582	hsa-miR-526b	CLIP-seq
MIRT893583	hsa-miR-532-3p	CLIP-seq
MIRT893584	hsa-miR-571	CLIP-seq
MIRT893585	hsa-miR-628-3p	CLIP-seq
MIRT893586	hsa-miR-629	CLIP-seq
MIRT893587	hsa-miR-770-5p	CLIP-seq
MIRT893588	hsa-miR-802	CLIP-seq
MIRT893557	hsa-miR-3157-5p	CLIP-seq
MIRT893565	hsa-miR-4252	CLIP-seq
MIRT893571	hsa-miR-4534	CLIP-seq
MIRT893574	hsa-miR-4691-3p	CLIP-seq
MIRT1964907	hsa-miR-1266	CLIP-seq
MIRT1964908	hsa-miR-1276	CLIP-seq
MIRT1964909	hsa-miR-128	CLIP-seq
MIRT1964910	hsa-miR-140-3p	CLIP-seq
MIRT893552	hsa-miR-145	CLIP-seq
MIRT1964911	hsa-miR-27a	CLIP-seq
MIRT1964912	hsa-miR-27b	CLIP-seq
MIRT893554	hsa-miR-3148	CLIP-seq
MIRT893555	hsa-miR-3155	CLIP-seq
MIRT893556	hsa-miR-3155b	CLIP-seq
MIRT893557	hsa-miR-3157-5p	CLIP-seq
MIRT893560	hsa-miR-338-5p	CLIP-seq
MIRT1964913	hsa-miR-3664-3p	CLIP-seq
MIRT893564	hsa-miR-3978	CLIP-seq
MIRT893565	hsa-miR-4252	CLIP-seq
MIRT1964914	hsa-miR-4270	CLIP-seq
MIRT1964915	hsa-miR-4441	CLIP-seq
MIRT893568	hsa-miR-4505	CLIP-seq
MIRT1964916	hsa-miR-4518	CLIP-seq
MIRT893569	hsa-miR-4529-5p	CLIP-seq
MIRT893571	hsa-miR-4534	CLIP-seq
MIRT893574	hsa-miR-4691-3p	CLIP-seq
MIRT893576	hsa-miR-4712-5p	CLIP-seq
MIRT893579	hsa-miR-484	CLIP-seq
MIRT1964917	hsa-miR-513a-5p	CLIP-seq
MIRT1964918	hsa-miR-548b-3p	CLIP-seq
MIRT893584	hsa-miR-571	CLIP-seq
MIRT1964919	hsa-miR-615-5p	CLIP-seq
MIRT893586	hsa-miR-629	CLIP-seq
MIRT893587	hsa-miR-770-5p	CLIP-seq
MIRT2200885	hsa-miR-1178	CLIP-seq
MIRT1964908	hsa-miR-1276	CLIP-seq
MIRT1964909	hsa-miR-128	CLIP-seq
MIRT1964910	hsa-miR-140-3p	CLIP-seq
MIRT893552	hsa-miR-145	CLIP-seq
MIRT893553	hsa-miR-188-3p	CLIP-seq
MIRT1964911	hsa-miR-27a	CLIP-seq
MIRT1964912	hsa-miR-27b	CLIP-seq
MIRT893554	hsa-miR-3148	CLIP-seq
MIRT2200886	hsa-miR-3151	CLIP-seq
MIRT893555	hsa-miR-3155	CLIP-seq
MIRT893556	hsa-miR-3155b	CLIP-seq
MIRT893557	hsa-miR-3157-5p	CLIP-seq
MIRT2200887	hsa-miR-3174	CLIP-seq
MIRT893558	hsa-miR-3202	CLIP-seq
MIRT893560	hsa-miR-338-5p	CLIP-seq
MIRT893563	hsa-miR-383	CLIP-seq
MIRT2200888	hsa-miR-3919	CLIP-seq
MIRT893564	hsa-miR-3978	CLIP-seq
MIRT893565	hsa-miR-4252	CLIP-seq
MIRT2200889	hsa-miR-4330	CLIP-seq
MIRT2200890	hsa-miR-4481	CLIP-seq
MIRT893568	hsa-miR-4505	CLIP-seq
MIRT893570	hsa-miR-4533	CLIP-seq
MIRT893572	hsa-miR-4643	CLIP-seq
MIRT893573	hsa-miR-466	CLIP-seq
MIRT893574	hsa-miR-4691-3p	CLIP-seq
MIRT2200891	hsa-miR-4695-3p	CLIP-seq
MIRT893576	hsa-miR-4712-5p	CLIP-seq
MIRT2200892	hsa-miR-4745-5p	CLIP-seq
MIRT2200893	hsa-miR-4756-3p	CLIP-seq
MIRT2200894	hsa-miR-4758-5p	CLIP-seq
MIRT893577	hsa-miR-4789-3p	CLIP-seq
MIRT893579	hsa-miR-484	CLIP-seq
MIRT2200895	hsa-miR-486-3p	CLIP-seq
MIRT1964917	hsa-miR-513a-5p	CLIP-seq
MIRT893580	hsa-miR-514	CLIP-seq
MIRT893581	hsa-miR-514b-3p	CLIP-seq
MIRT893583	hsa-miR-532-3p	CLIP-seq
MIRT2200896	hsa-miR-548a-3p	CLIP-seq
MIRT2200897	hsa-miR-548e	CLIP-seq
MIRT2200898	hsa-miR-548f	CLIP-seq
MIRT893584	hsa-miR-571	CLIP-seq
MIRT893586	hsa-miR-629	CLIP-seq
MIRT893587	hsa-miR-770-5p	CLIP-seq
MIRT2200885	hsa-miR-1178	CLIP-seq
MIRT1964908	hsa-miR-1276	CLIP-seq
MIRT1964909	hsa-miR-128	CLIP-seq
MIRT1964910	hsa-miR-140-3p	CLIP-seq
MIRT893552	hsa-miR-145	CLIP-seq
MIRT1964911	hsa-miR-27a	CLIP-seq
MIRT1964912	hsa-miR-27b	CLIP-seq
MIRT2503734	hsa-miR-3064-3p	CLIP-seq
MIRT893554	hsa-miR-3148	CLIP-seq
MIRT893557	hsa-miR-3157-5p	CLIP-seq
MIRT893564	hsa-miR-3978	CLIP-seq
MIRT893565	hsa-miR-4252	CLIP-seq
MIRT893571	hsa-miR-4534	CLIP-seq
MIRT893574	hsa-miR-4691-3p	CLIP-seq
MIRT893576	hsa-miR-4712-5p	CLIP-seq
MIRT1964917	hsa-miR-513a-5p	CLIP-seq
MIRT893584	hsa-miR-571	CLIP-seq
MIRT1964919	hsa-miR-615-5p	CLIP-seq
MIRT893587	hsa-miR-770-5p	CLIP-seq
MIRT2200885	hsa-miR-1178	CLIP-seq
MIRT1964908	hsa-miR-1276	CLIP-seq
MIRT1964910	hsa-miR-140-3p	CLIP-seq
MIRT2503734	hsa-miR-3064-3p	CLIP-seq
MIRT893554	hsa-miR-3148	CLIP-seq
MIRT893564	hsa-miR-3978	CLIP-seq
MIRT893584	hsa-miR-571	CLIP-seq
MIRT1964919	hsa-miR-615-5p	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IDA	11574538, 16513844
GO:0005515	Function	Protein binding	IPI	16189514, 16513844, 16713569, 21516116, 22365833, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	HDA	16791210
GO:0005634	Component	Nucleus	IDA	11574538
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005681	Component	Spliceosomal complex	IBA
GO:0005737	Component	Cytoplasm	IDA	11574538
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0009409	Process	Response to cold	IEA
GO:0009409	Process	Response to cold	TAS	9151692
GO:0009411	Process	Response to UV	IDA	11574538
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0017148	Process	Negative regulation of translation	IEA
GO:0030371	Function	Translation repressor activity	ISS
GO:0034063	Process	Stress granule assembly	ISS
GO:0045727	Process	Positive regulation of translation	IDA	11574538
GO:0048026	Process	Positive regulation of mRNA splicing, via spliceosome	IBA
GO:0048255	Process	MRNA stabilization	IDA	11574538
GO:0070181	Function	Small ribosomal subunit rRNA binding	IDA	11574538

MIM	HGNC	e!Ensembl
602649	1982	ENSG00000099622

Q14011

Protein name

Cold-inducible RNA-binding protein (A18 hnRNP) (Glycine-rich RNA-binding protein CIRP)

Protein function

Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced s

PDB

1X5S , 5TBX , 8CMK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	8 → 78	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDA
KDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD
RGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE

Sequence length

172

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Arthritis Rheumatoid	Associate	34177888	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	40708018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	33433612	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	19777567, 33172965, 40320538	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Associate	30315244	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	32312268	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Stimulate	38565387	★★★★★ ★☆☆☆☆ Found in Text Mining only
Embolic Stroke	Associate	40708018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Inhibit	19777567	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	36899615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Associate	39287291	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Associate	33172965	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothermia	Stimulate	31821351	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Associate	36211820	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia Brain	Associate	31940282, 36211820	★★★★★ ★☆☆☆☆ Found in Text Mining only
IgA Vasculitis	Associate	38565387	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	40025620	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	33172965, 36920542, 38565387	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	40025620	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25934796, 33172965, 33429432, 40708018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	26568413	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	36061308	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	36170814	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	36061308	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Associate	25934796	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	19277990	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Stimulate	30315244	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Associate	38565387	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Stimulate	36920542	★★★★★ ★☆☆☆☆ Found in Text Mining only

CIRBP (cold inducible RNA binding protein)