Gene Gene information from NCBI Gene database.
Entrez ID 1153
Gene name Cold inducible RNA binding protein
Gene symbol CIRBP
Synonyms (NCBI Gene)
CIRP
Chromosome 19
Chromosome location 19p13.3
miRNA miRNA information provided by mirtarbase database.
145
miRTarBase ID miRNA Experiments Reference
MIRT028434 hsa-miR-30a-5p Proteomics 18668040
MIRT030423 hsa-miR-24-3p Microarray 19748357
MIRT893552 hsa-miR-145 CLIP-seq
MIRT893553 hsa-miR-188-3p CLIP-seq
MIRT893554 hsa-miR-3148 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IBA
GO:0003723 Function RNA binding IEA
GO:0003730 Function MRNA 3'-UTR binding IDA 11574538, 16513844
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602649 1982 ENSG00000099622
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14011
Protein name Cold-inducible RNA-binding protein (A18 hnRNP) (Glycine-rich RNA-binding protein CIRP)
Protein function Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced s
PDB 1X5S , 5TBX , 8CMK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 8 78 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDA
KDAMMAMNGKSVDGRQIR
VDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD
RGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Sequence length 172
Interactions View interactions