Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1153
Gene name Gene Name - the full gene name approved by the HGNC.
Cold inducible RNA binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CIRBP
Synonyms (NCBI Gene) Gene synonyms aliases
CIRP
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028434 hsa-miR-30a-5p Proteomics 18668040
MIRT030423 hsa-miR-24-3p Microarray 19748357
MIRT893552 hsa-miR-145 CLIP-seq
MIRT893553 hsa-miR-188-3p CLIP-seq
MIRT893554 hsa-miR-3148 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003730 Function MRNA 3'-UTR binding IDA 11574538, 16513844
GO:0005515 Function Protein binding IPI 16189514, 16513844, 16713569, 21516116, 22365833, 25416956, 29892012, 31515488, 32296183, 32814053
GO:0005634 Component Nucleus HDA 16791210
GO:0005634 Component Nucleus IDA 11574538
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602649 1982 ENSG00000099622
Protein
UniProt ID Q14011
Protein name Cold-inducible RNA-binding protein (A18 hnRNP) (Glycine-rich RNA-binding protein CIRP)
Protein function Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced s
PDB 1X5S , 5TBX , 8CMK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 8 78 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDA
KDAMMAMNGKSVDGRQIR
VDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD
RGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE
Sequence length 172
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Autism spectrum disorder Autism Spectrum Disorders rs724159978, rs75184679, rs119103221, rs9332964, rs121912562, rs1594344233, rs727504317, rs111033204, rs1801086, rs587784464, rs724159948, rs764659822, rs794727977, rs796052733, rs796052728
View all (51 more)
24781735
Associations from Text Mining
Disease Name Relationship Type References
Arthritis Rheumatoid Associate 34177888
Atherosclerosis Associate 40708018
Brain Neoplasms Associate 33433612
Breast Neoplasms Associate 19777567, 33172965, 40320538
Carcinogenesis Associate 30315244
Diabetes Mellitus Associate 32312268
Drug Related Side Effects and Adverse Reactions Stimulate 38565387
Embolic Stroke Associate 40708018
Endometrial Neoplasms Inhibit 19777567
Endometrial Neoplasms Associate 36899615