Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	115286
Gene name	Solute carrier family 25 member 26
Gene symbol	SLC25A26
Synonyms (NCBI Gene)	COXPD28SAMC
Chromosome	3
Chromosome location	3p14.1
Summary	This gene is a member of the mitochondrial carrier family which includes nuclear-encoded transporters localized on the inner mitochondrial membranes. Members of the family transport important small molecules across the mitochondrial inner membrane. This p

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs781798317	G>A	Pathogenic	Splice donor variant, intron variant
rs869025313	T>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs869025314	C>T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs869025315	C>T	Pathogenic	Genic downstream transcript variant, missense variant, non coding transcript variant, coding sequence variant

111

Show/Hide all (111)

miRTarBase ID	miRNA	Experiments	Reference
MIRT722971	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT722970	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT722969	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT722968	hsa-miR-4660	HITS-CLIP	19536157
MIRT722967	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT722966	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT722965	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT722964	hsa-miR-7156-3p	HITS-CLIP	19536157
MIRT722963	hsa-miR-1301-3p	HITS-CLIP	19536157
MIRT722962	hsa-miR-5047	HITS-CLIP	19536157
MIRT722961	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT722960	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT722959	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT722971	hsa-miR-329-3p	HITS-CLIP	19536157
MIRT722970	hsa-miR-362-3p	HITS-CLIP	19536157
MIRT722969	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT722968	hsa-miR-4660	HITS-CLIP	19536157
MIRT722967	hsa-miR-3160-5p	HITS-CLIP	19536157
MIRT722966	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT722965	hsa-miR-6873-3p	HITS-CLIP	19536157
MIRT722964	hsa-miR-7156-3p	HITS-CLIP	19536157
MIRT722963	hsa-miR-1301-3p	HITS-CLIP	19536157
MIRT722962	hsa-miR-5047	HITS-CLIP	19536157
MIRT722961	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT722960	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT722959	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT1356095	hsa-miR-1256	CLIP-seq
MIRT1356096	hsa-miR-3616-5p	CLIP-seq
MIRT1356097	hsa-miR-3647-5p	CLIP-seq
MIRT1356098	hsa-miR-4711-3p	CLIP-seq
MIRT1356099	hsa-miR-4795-5p	CLIP-seq
MIRT1356100	hsa-miR-495	CLIP-seq
MIRT1356101	hsa-miR-511	CLIP-seq
MIRT1356102	hsa-miR-573	CLIP-seq
MIRT2105394	hsa-miR-1324	CLIP-seq
MIRT2105395	hsa-miR-183	CLIP-seq
MIRT2329953	hsa-miR-1237	CLIP-seq
MIRT2329954	hsa-miR-141	CLIP-seq
MIRT2329955	hsa-miR-200a	CLIP-seq
MIRT2329956	hsa-miR-2467-5p	CLIP-seq
MIRT2329957	hsa-miR-3166	CLIP-seq
MIRT2329958	hsa-miR-3188	CLIP-seq
MIRT2329959	hsa-miR-3689d	CLIP-seq
MIRT2329960	hsa-miR-3975	CLIP-seq
MIRT2329961	hsa-miR-4316	CLIP-seq
MIRT2329962	hsa-miR-4710	CLIP-seq
MIRT1356099	hsa-miR-4795-5p	CLIP-seq
MIRT2329963	hsa-miR-485-5p	CLIP-seq
MIRT2329964	hsa-miR-642b	CLIP-seq
MIRT2624143	hsa-miR-1205	CLIP-seq
MIRT2105394	hsa-miR-1324	CLIP-seq
MIRT2624144	hsa-miR-136	CLIP-seq
MIRT2624145	hsa-miR-1972	CLIP-seq
MIRT2624146	hsa-miR-3065-3p	CLIP-seq
MIRT2624147	hsa-miR-3128	CLIP-seq
MIRT2624148	hsa-miR-3194-5p	CLIP-seq
MIRT2624149	hsa-miR-326	CLIP-seq
MIRT2624150	hsa-miR-330-5p	CLIP-seq
MIRT2624151	hsa-miR-3663-5p	CLIP-seq
MIRT2624152	hsa-miR-4291	CLIP-seq
MIRT2624153	hsa-miR-4325	CLIP-seq
MIRT2624154	hsa-miR-4418	CLIP-seq
MIRT2624155	hsa-miR-4438	CLIP-seq
MIRT2624156	hsa-miR-4659a-3p	CLIP-seq
MIRT2624157	hsa-miR-4659b-3p	CLIP-seq
MIRT2624158	hsa-miR-4720-5p	CLIP-seq
MIRT2624159	hsa-miR-4753-3p	CLIP-seq
MIRT1356099	hsa-miR-4795-5p	CLIP-seq
MIRT2624160	hsa-miR-4799-3p	CLIP-seq
MIRT2624161	hsa-miR-485-3p	CLIP-seq
MIRT2624162	hsa-miR-507	CLIP-seq
MIRT2624163	hsa-miR-509-3-5p	CLIP-seq
MIRT2624164	hsa-miR-5095	CLIP-seq
MIRT2624165	hsa-miR-509-5p	CLIP-seq
MIRT2624166	hsa-miR-557	CLIP-seq
MIRT2624167	hsa-miR-582-3p	CLIP-seq
MIRT2624168	hsa-miR-617	CLIP-seq
MIRT2624169	hsa-miR-634	CLIP-seq
MIRT2624170	hsa-miR-767-3p	CLIP-seq
MIRT2624171	hsa-miR-942	CLIP-seq
MIRT2624143	hsa-miR-1205	CLIP-seq
MIRT2691003	hsa-miR-1305	CLIP-seq
MIRT2105394	hsa-miR-1324	CLIP-seq
MIRT2624144	hsa-miR-136	CLIP-seq
MIRT2624146	hsa-miR-3065-3p	CLIP-seq
MIRT2691004	hsa-miR-320a	CLIP-seq
MIRT2691005	hsa-miR-320b	CLIP-seq
MIRT2691006	hsa-miR-320c	CLIP-seq
MIRT2691007	hsa-miR-320d	CLIP-seq
MIRT2691008	hsa-miR-320e	CLIP-seq
MIRT2624149	hsa-miR-326	CLIP-seq
MIRT2691009	hsa-miR-330-3p	CLIP-seq
MIRT2624150	hsa-miR-330-5p	CLIP-seq
MIRT2624151	hsa-miR-3663-5p	CLIP-seq
MIRT2624152	hsa-miR-4291	CLIP-seq
MIRT2624153	hsa-miR-4325	CLIP-seq
MIRT2624154	hsa-miR-4418	CLIP-seq
MIRT2691010	hsa-miR-4429	CLIP-seq
MIRT2624156	hsa-miR-4659a-3p	CLIP-seq
MIRT2624157	hsa-miR-4659b-3p	CLIP-seq
MIRT2691011	hsa-miR-4722-3p	CLIP-seq
MIRT2624159	hsa-miR-4753-3p	CLIP-seq
MIRT2691012	hsa-miR-4793-5p	CLIP-seq
MIRT2624162	hsa-miR-507	CLIP-seq
MIRT2624163	hsa-miR-509-3-5p	CLIP-seq
MIRT2624165	hsa-miR-509-5p	CLIP-seq
MIRT2624166	hsa-miR-557	CLIP-seq
MIRT2624167	hsa-miR-582-3p	CLIP-seq
MIRT2691013	hsa-miR-607	CLIP-seq
MIRT2624170	hsa-miR-767-3p	CLIP-seq
MIRT2624171	hsa-miR-942	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000095	Function	S-adenosyl-L-methionine transmembrane transporter activity	EXP	14674884, 26522469
GO:0000095	Function	S-adenosyl-L-methionine transmembrane transporter activity	IBA
GO:0000095	Function	S-adenosyl-L-methionine transmembrane transporter activity	IMP	14674884
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IDA	14674884
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0015297	Function	Antiporter activity	IEA
GO:0015805	Process	S-adenosyl-L-methionine transport	IMP	14674884
GO:0015860	Process	Purine nucleoside transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0043414	Process	Macromolecule methylation	IMP	26522469
GO:0180003	Function	S-adenosyl-L-methionine:S-adenosyl-L-homocysteine antiporter activity	IMP	26522469, 34375635
GO:1902475	Process	L-alpha-amino acid transmembrane transport	IEA
GO:1990543	Process	Mitochondrial S-adenosyl-L-methionine transmembrane transport	IMP	26522469, 34375635

MIM	HGNC	e!Ensembl
611037	20661	ENSG00000144741

Q70HW3

Protein name

Mitochondrial S-adenosylmethionine carrier protein (SAM carrier) (Solute carrier family 25 member 26)

Protein function

Mitochondrial S-adenosyl-L-methionine/S-adenosyl-L-homocysteine antiporter. Mediates the exchange of cytosolic S-adenosyl-L-methionine, the predominant methyl-group donor for macromolecule methylation processes, for mitochondrial S-adenosylhomoc

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00153	Mito_carr	2 → 44	Mitochondrial carrier protein	Family
PF00153	Mito_carr	84 → 173	Mitochondrial carrier protein	Family
PF00153	Mito_carr	176 → 269	Mitochondrial carrier protein	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Highly expressed in testis, with moderate expression in brain, heart, kidney, lung, skeletal muscle, pancreas, small intestine and liver, and low expression in spleen. {ECO:0000269|PubMed:14674884}.

Sequence

MDRPGFVAALVAGGVAGVSVDLILFPLDTIKTRLQSPQGFSKAGGFHGIYAGVPSAAIGS
FPNAAAFFITYEYVKWFLHADSSSYLTPMKHMLAASAGEVVACLIRVPSEVVKQRAQVSA
STRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSW
QSAVCGAFAGGFAAAVTTPLDVAKTRITLAKAGSSTADGNVLSVLHGVWRSQGLAGLFAG
VFPRMAAISLGGFIFLGAYDRTHSLLLEVGRKSP

Sequence length

274

Interactions

View interactions

	Reactome
			Transport of inorganic cations/anions and amino acids/oligopeptides

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Combined oxidative phosphorylation deficiency 28	Pathogenic; Likely pathogenic	rs869025313, rs869025314, rs869025315, rs781798317, rs1316228094	RCV000207467 RCV000207457 RCV000207463 RCV000207470 RCV003405148

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs108941, rs36174201	RCV005914644 RCV005902379
Gastric cancer	Benign	rs332387, rs141974918	RCV005906878 RCV005907407
Hepatocellular carcinoma	Benign	rs332387	RCV005906876
Hypokalemic periodic paralysis, type 1	Uncertain significance	rs2472133539	RCV002285097
Malignant lymphoma, large B-cell, diffuse	Benign	rs332387, rs141974918	RCV005906877 RCV005907406
Malignant tumor of esophagus	Benign	rs141974918	RCV005907405
Sarcoma	Likely benign	rs377402280	RCV005932102
SLC25A26-related disorder	Likely benign; Uncertain significance; Benign	rs373565149, rs781692480, rs782542054, rs1312131978, rs146159281, rs3772197	RCV003968542 RCV003918907 RCV003942307 RCV003954818 RCV003975361 RCV003975344
Thymoma	Benign; Likely benign	rs108941, rs189816697, rs141974918	RCV005914645 RCV005920850 RCV005907408
Uterine carcinosarcoma	Benign	rs332387, rs36174201	RCV005906879 RCV005902380
Uterine corpus endometrial carcinoma	Benign; Likely benign	rs108941, rs189816697	RCV005914646 RCV005920851

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Edema	Associate	26522469
Inflammation	Inhibit	37002570
Mitochondrial Diseases	Associate	26522469
Mitochondrial Myopathy with a Defect in Mitochondrial Protein Transport	Associate	26522469
Muscle Weakness	Associate	26522469
Muscular Diseases	Associate	35216315
Neoplasms	Inhibit	37002570
Pulmonary Disease Chronic Obstructive	Inhibit	37002570
Renal Insufficiency	Associate	26522469
Respiratory Insufficiency	Associate	26522469
Uterine Cervical Neoplasms	Inhibit	28118529

SLC25A26 (solute carrier family 25 member 26)