Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1152
Gene name	Creatine kinase B
Gene symbol	CKB
Synonyms (NCBI Gene)	B-CKBCKCKBBCPK-BHEL-211HEL-S-29
Chromosome	14
Chromosome location	14q32.33
Summary	The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in brain as

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052190	hsa-let-7b-5p	CLASH	23622248
MIRT049124	hsa-miR-92a-3p	CLASH	23622248
MIRT044642	hsa-miR-320a	CLASH	23622248
MIRT043074	hsa-miR-324-5p	CLASH	23622248
MIRT042718	hsa-miR-346	CLASH	23622248
MIRT042674	hsa-miR-196b-5p	CLASH	23622248
MIRT037448	hsa-miR-744-5p	CLASH	23622248
MIRT037448	hsa-miR-744-5p	CLASH	23622248
MIRT036653	hsa-miR-935	CLASH	23622248
MIRT036653	hsa-miR-935	CLASH	23622248
MIRT052723	hsa-miR-1260b	CLASH	23622248
MIRT736752	hsa-miR-483-5p	Luciferase reporter assayqRT-PCR	25601461
MIRT731201	hsa-miR-551a	Luciferase reporter assayqRT-PCR	25601461
MIRT731201	hsa-miR-551a	Luciferase reporter assayqRT-PCR	25601461
MIRT735898	hsa-miR-483-3p	Luciferase reporter assayWestern blottingqRT-PCR	31792031
MIRT736752	hsa-miR-483-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	25601461
MIRT731201	hsa-miR-551a	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	25601461
MIRT894208	hsa-miR-214	CLIP-seq
MIRT894209	hsa-miR-3619-5p	CLIP-seq
MIRT894210	hsa-miR-4291	CLIP-seq
MIRT894211	hsa-miR-4310	CLIP-seq
MIRT894212	hsa-miR-4645-5p	CLIP-seq
MIRT894213	hsa-miR-4662a-5p	CLIP-seq
MIRT894214	hsa-miR-4673	CLIP-seq
MIRT894215	hsa-miR-4711-5p	CLIP-seq
MIRT894216	hsa-miR-4742-5p	CLIP-seq
MIRT894217	hsa-miR-541	CLIP-seq
MIRT894218	hsa-miR-654-5p	CLIP-seq
MIRT894219	hsa-miR-761	CLIP-seq
MIRT894220	hsa-miR-922	CLIP-seq
MIRT1965138	hsa-miR-139-5p	CLIP-seq
MIRT894208	hsa-miR-214	CLIP-seq
MIRT1965139	hsa-miR-3120-3p	CLIP-seq
MIRT1965140	hsa-miR-342-5p	CLIP-seq
MIRT894209	hsa-miR-3619-5p	CLIP-seq
MIRT894210	hsa-miR-4291	CLIP-seq
MIRT894211	hsa-miR-4310	CLIP-seq
MIRT894213	hsa-miR-4662a-5p	CLIP-seq
MIRT1965141	hsa-miR-4664-5p	CLIP-seq
MIRT1965142	hsa-miR-4684-5p	CLIP-seq
MIRT894215	hsa-miR-4711-5p	CLIP-seq
MIRT894219	hsa-miR-761	CLIP-seq
MIRT894220	hsa-miR-922	CLIP-seq
MIRT1965140	hsa-miR-342-5p	CLIP-seq
MIRT1965141	hsa-miR-4664-5p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004111	Function	Creatine kinase activity	IBA
GO:0004111	Function	Creatine kinase activity	IDA	8186255
GO:0004111	Function	Creatine kinase activity	IEA
GO:0004111	Function	Creatine kinase activity	ISS
GO:0004111	Function	Creatine kinase activity	TAS	3034271
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 19264780, 21145461, 25416956, 28514442, 32296183, 33961781, 35271311, 37207277
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016772	Function	Transferase activity, transferring phosphorus-containing groups	IEA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	19725078
GO:0046314	Process	Phosphocreatine biosynthetic process	IBA
GO:0046314	Process	Phosphocreatine biosynthetic process	IDA	8186255
GO:0046314	Process	Phosphocreatine biosynthetic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	11487543, 19056867, 23533145
GO:0140651	Process	Futile creatine cycle	IEA

MIM	HGNC	e!Ensembl
123280	1991	ENSG00000166165

P12277

Protein name

Creatine kinase B-type (EC 2.7.3.2) (Brain creatine kinase) (B-CK) (Creatine kinase B chain) (Creatine phosphokinase B-type) (CPK-B)

Protein function

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate) (PubMed:8186255). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demand

PDB

3B6R , 3DRB , 3DRE , 6V9H , 7BF1 , 7TUN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02807	ATP-gua_PtransN	24 → 94	ATP:guanido phosphotransferase, N-terminal domain	Domain
PF00217	ATP-gua_Ptrans	153 → 367	ATP:guanido phosphotransferase, C-terminal catalytic domain	Domain

Sequence

MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTG
VDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISM
QKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
NLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK

Sequence length

381

Interactions

View interactions

	KEGG		Reactome
	Arginine and proline metabolism Metabolic pathways		Creatine metabolism

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Premature ovarian insufficiency	Uncertain significance	rs1041105054	RCV000766146

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Associate	36750132
Acute Kidney Injury	Associate	37396184
Adenocarcinoma of Lung	Associate	33021972
Alzheimer Disease	Inhibit	10820214
Breast Neoplasms	Associate	3733865
Carcinogenesis	Associate	27149373
Carcinoma Small Cell	Stimulate	30358701
Carcinoma Squamous Cell	Associate	22500095
Colorectal Neoplasms	Inhibit	21308735
Creatine deficiency X linked	Associate	23049898
Diabetes Mellitus Type 2	Associate	12531894
Diabetic Nephropathies	Associate	37396184
Failed Back Surgery Syndrome	Associate	12039490
Genetic Diseases Inborn	Associate	23049898
Hepatoblastoma	Associate	39684755
Hypoxia	Associate	23269812
Insulin Resistance	Stimulate	36750132
Lewy Body Disease	Inhibit	10820214
Macular Degeneration	Associate	32209064
Muscular Dystrophies	Associate	27149373
Neoplasm Metastasis	Associate	26460485
Neoplasms	Associate	21308735, 26460485, 26772741, 32253542, 39684755
Neoplasms Squamous Cell	Associate	22298307
Neurodegenerative Diseases	Inhibit	10820214
Osler rendu weber syndrome 2	Associate	23882694
Pick Disease of the Brain	Inhibit	10820214
Polycystic Ovary Syndrome	Associate	36750132
Precancerous Conditions	Associate	22298307
Prostatitis	Associate	3552321
Pulmonary edema of mountaineers	Associate	40640242
Retinitis	Associate	23882694
Small Cell Lung Carcinoma	Associate	2438285, 28448532, 2883200
Stomach Neoplasms	Associate	26460485
Varicose Veins	Associate	24183353

CKB (creatine kinase B)