Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	114971
Gene name	Protein tyrosine phosphatase mitochondrial 1
Gene symbol	PTPMT1
Synonyms (NCBI Gene)	DUSP23MOSPNEDAXBAPLIPPNAS-129
Chromosome	11
Chromosome location	11p11.2

113

Show/Hide all (113)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019753	hsa-miR-375	Microarray	20215506
MIRT023582	hsa-miR-1-3p	Proteomics	18668040
MIRT045130	hsa-miR-186-5p	CLASH	23622248
MIRT037666	hsa-miR-744-5p	CLASH	23622248
MIRT1274344	hsa-miR-3150a-3p	CLIP-seq
MIRT1274345	hsa-miR-3151	CLIP-seq
MIRT1274346	hsa-miR-3175	CLIP-seq
MIRT1274347	hsa-miR-4447	CLIP-seq
MIRT1274348	hsa-miR-4472	CLIP-seq
MIRT1274349	hsa-miR-4728-5p	CLIP-seq
MIRT1274350	hsa-miR-491-5p	CLIP-seq
MIRT1274351	hsa-miR-939	CLIP-seq
MIRT1274352	hsa-miR-1285	CLIP-seq
MIRT1274353	hsa-miR-133a	CLIP-seq
MIRT1274354	hsa-miR-133b	CLIP-seq
MIRT1274355	hsa-miR-146b-3p	CLIP-seq
MIRT1274356	hsa-miR-190	CLIP-seq
MIRT1274357	hsa-miR-190b	CLIP-seq
MIRT1274358	hsa-miR-1915	CLIP-seq
MIRT1274359	hsa-miR-3164	CLIP-seq
MIRT1274360	hsa-miR-3179	CLIP-seq
MIRT1274361	hsa-miR-3187-5p	CLIP-seq
MIRT1274362	hsa-miR-3201	CLIP-seq
MIRT1274363	hsa-miR-378g	CLIP-seq
MIRT1274364	hsa-miR-3936	CLIP-seq
MIRT1274365	hsa-miR-4436a	CLIP-seq
MIRT1274366	hsa-miR-4452	CLIP-seq
MIRT1274367	hsa-miR-4486	CLIP-seq
MIRT1274368	hsa-miR-4652-3p	CLIP-seq
MIRT1274369	hsa-miR-4709-5p	CLIP-seq
MIRT1274370	hsa-miR-4711-3p	CLIP-seq
MIRT1274371	hsa-miR-4720-3p	CLIP-seq
MIRT1274372	hsa-miR-4726-3p	CLIP-seq
MIRT1274373	hsa-miR-4791	CLIP-seq
MIRT1274374	hsa-miR-498	CLIP-seq
MIRT1274375	hsa-miR-570	CLIP-seq
MIRT1274376	hsa-miR-598	CLIP-seq
MIRT1274377	hsa-miR-612	CLIP-seq
MIRT1274378	hsa-miR-653	CLIP-seq
MIRT1274352	hsa-miR-1285	CLIP-seq
MIRT1274353	hsa-miR-133a	CLIP-seq
MIRT1274354	hsa-miR-133b	CLIP-seq
MIRT1274355	hsa-miR-146b-3p	CLIP-seq
MIRT1274361	hsa-miR-3187-5p	CLIP-seq
MIRT1274363	hsa-miR-378g	CLIP-seq
MIRT1274367	hsa-miR-4486	CLIP-seq
MIRT1274368	hsa-miR-4652-3p	CLIP-seq
MIRT1274371	hsa-miR-4720-3p	CLIP-seq
MIRT1274376	hsa-miR-598	CLIP-seq
MIRT1274377	hsa-miR-612	CLIP-seq
MIRT2306791	hsa-miR-1271	CLIP-seq
MIRT1274352	hsa-miR-1285	CLIP-seq
MIRT2306792	hsa-miR-129-5p	CLIP-seq
MIRT2306793	hsa-miR-182	CLIP-seq
MIRT2306794	hsa-miR-224	CLIP-seq
MIRT1274361	hsa-miR-3187-5p	CLIP-seq
MIRT2306795	hsa-miR-335	CLIP-seq
MIRT1274363	hsa-miR-378g	CLIP-seq
MIRT2306796	hsa-miR-3914	CLIP-seq
MIRT2306797	hsa-miR-4307	CLIP-seq
MIRT1274367	hsa-miR-4486	CLIP-seq
MIRT1274368	hsa-miR-4652-3p	CLIP-seq
MIRT1274371	hsa-miR-4720-3p	CLIP-seq
MIRT1274376	hsa-miR-598	CLIP-seq
MIRT1274377	hsa-miR-612	CLIP-seq
MIRT2306798	hsa-miR-96	CLIP-seq
MIRT1274352	hsa-miR-1285	CLIP-seq
MIRT2604455	hsa-miR-140-3p	CLIP-seq
MIRT2604456	hsa-miR-1914	CLIP-seq
MIRT1274358	hsa-miR-1915	CLIP-seq
MIRT2604457	hsa-miR-197	CLIP-seq
MIRT2604458	hsa-miR-2117	CLIP-seq
MIRT2604459	hsa-miR-2278	CLIP-seq
MIRT1274361	hsa-miR-3187-5p	CLIP-seq
MIRT2604460	hsa-miR-3194-5p	CLIP-seq
MIRT2604461	hsa-miR-3622a-5p	CLIP-seq
MIRT1274363	hsa-miR-378g	CLIP-seq
MIRT2604462	hsa-miR-3938	CLIP-seq
MIRT2604463	hsa-miR-4273	CLIP-seq
MIRT2604464	hsa-miR-4279	CLIP-seq
MIRT2604465	hsa-miR-4330	CLIP-seq
MIRT2604466	hsa-miR-4423-3p	CLIP-seq
MIRT1274365	hsa-miR-4436a	CLIP-seq
MIRT1274367	hsa-miR-4486	CLIP-seq
MIRT2604467	hsa-miR-4645-3p	CLIP-seq
MIRT1274368	hsa-miR-4652-3p	CLIP-seq
MIRT2604468	hsa-miR-4677-5p	CLIP-seq
MIRT2604469	hsa-miR-4717-5p	CLIP-seq
MIRT1274372	hsa-miR-4726-3p	CLIP-seq
MIRT2604470	hsa-miR-4727-5p	CLIP-seq
MIRT2604471	hsa-miR-4769-3p	CLIP-seq
MIRT2604472	hsa-miR-4793-5p	CLIP-seq
MIRT2604473	hsa-miR-550a	CLIP-seq
MIRT1274376	hsa-miR-598	CLIP-seq
MIRT1274377	hsa-miR-612	CLIP-seq
MIRT2604455	hsa-miR-140-3p	CLIP-seq
MIRT2604456	hsa-miR-1914	CLIP-seq
MIRT2604457	hsa-miR-197	CLIP-seq
MIRT2604458	hsa-miR-2117	CLIP-seq
MIRT2604459	hsa-miR-2278	CLIP-seq
MIRT2604460	hsa-miR-3194-5p	CLIP-seq
MIRT2604461	hsa-miR-3622a-5p	CLIP-seq
MIRT2604462	hsa-miR-3938	CLIP-seq
MIRT2604463	hsa-miR-4273	CLIP-seq
MIRT2604464	hsa-miR-4279	CLIP-seq
MIRT2604465	hsa-miR-4330	CLIP-seq
MIRT2604466	hsa-miR-4423-3p	CLIP-seq
MIRT2604467	hsa-miR-4645-3p	CLIP-seq
MIRT2604469	hsa-miR-4717-5p	CLIP-seq
MIRT2604470	hsa-miR-4727-5p	CLIP-seq
MIRT2604471	hsa-miR-4769-3p	CLIP-seq
MIRT2604472	hsa-miR-4793-5p	CLIP-seq
MIRT2604473	hsa-miR-550a	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004439	Function	Phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IBA
GO:0004439	Function	Phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005515	Function	Protein binding	IPI	21516116, 24709986, 25416956, 32296183
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	38322995
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006655	Process	Phosphatidylglycerol biosynthetic process	IEA
GO:0008654	Process	Phospholipid biosynthetic process	IEA
GO:0008962	Function	Phosphatidylglycerophosphatase activity	IBA
GO:0008962	Function	Phosphatidylglycerophosphatase activity	IEA
GO:0008962	Function	Phosphatidylglycerophosphatase activity	ISS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0032049	Process	Cardiolipin biosynthetic process	IEA
GO:0032049	Process	Cardiolipin biosynthetic process	ISS
GO:0032049	Process	Cardiolipin biosynthetic process	TAS	38322995
GO:2001242	Process	Regulation of intrinsic apoptotic signaling pathway	IGI	24709986

MIM	HGNC	e!Ensembl
609538	26965	ENSG00000110536

Q8WUK0

Protein name

Phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 (EC 3.1.3.27) (PTEN-like phosphatase) (Phosphoinositide lipid phosphatase) (Protein-tyrosine phosphatase mitochondrial 1) (EC 3.1.3.16, EC 3.1.3.48)

Protein function

Lipid phosphatase which dephosphorylates phosphatidylglycerophosphate (PGP) to phosphatidylglycerol (PG) (By similarity). PGP is an essential intermediate in the biosynthetic pathway of cardiolipin, a mitochondrial-specific phospholipid regulati

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00782	DSPc	51 → 185	Dual specificity phosphatase, catalytic domain	Domain

Sequence

MAATALLEAGLARVLFYPTLLYTLFRGKVPGRAHRDWYHRIDPTVLLGALPLRSLTRQLV
QDENVRGVITMNEEYETRFLCNSSQEWKRLGVEQLRLSTVDMTGIPTLDNLQKGVQFALK
YQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWSPEEAVRAIAKIRSYIHIRPGQLDVLK
EFHKQITARATKDGTFVISKT

Sequence length

201

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	33992102	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Stimulate	35000852	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Associate	37104866	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	23326511	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	26449484	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	35000852	★★★★★ ★☆☆☆☆ Found in Text Mining only

PTPMT1 (protein tyrosine phosphatase mitochondrial 1)