Gene Gene information from NCBI Gene database.
Entrez ID 114907
Gene name F-box protein 32
Gene symbol FBXO32
Synonyms (NCBI Gene)
Fbx32MAFbx
Chromosome 8
Chromosome location 8q24.13
Summary This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
miRNA miRNA information provided by mirtarbase database.
1061
miRTarBase ID miRNA Experiments Reference
MIRT437412 hsa-miR-608 Luciferase reporter assayMicroarrayqRT-PCR 23796562
MIRT437412 hsa-miR-608 Luciferase reporter assayMicroarrayqRT-PCR 23796562
MIRT437473 rno-miR-19a-3p Luciferase reporter assay 24117217
MIRT437473 rno-miR-19a-3p Luciferase reporter assay 24117217
MIRT437474 rno-miR-19b-3p Luciferase reporter assay 24117217
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
EZH2 Repression 21546904
EZH2 Unknown 24213577
SMAD4 Unknown 20065949
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 18354498
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606604 16731 ENSG00000156804
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q969P5
Protein name F-box only protein 32 (Atrogin-1) (Muscle atrophy F-box protein) (MAFbx)
Protein function Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated t
Family and domains
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in cardiac and skeletal muscle.
Sequence
MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVA
AKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN
YVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTL
VQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRL
SDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
VRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Sequence length 355
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  FoxO signaling pathway   Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
OMIM: 606604 Likely pathogenic rs2130498264 RCV001548751
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Stimulate 29129636
Atrophy Associate 15100091, 16916907, 18240972, 22518834, 27526027, 28947926, 37335026
Breast Neoplasms Associate 17437993, 34197655
Burns Stimulate 23816995
Carcinogenesis Inhibit 32516567
Carcinoma Pancreatic Ductal Stimulate 35046938
Cardiomyopathy Dilated Associate 26753747, 36344977
Colorectal Neoplasms Associate 29465067
Cryopyrin Associated Periodic Syndromes Stimulate 37380094
Diabetes Mellitus Associate 20966391