Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
114907
Gene name Gene Name - the full gene name approved by the HGNC.
F-box protein 32
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FBXO32
Synonyms (NCBI Gene) Gene synonyms aliases
Fbx32, MAFbx
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q24.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT437412 hsa-miR-608 Luciferase reporter assay, Microarray, qRT-PCR 23796562
MIRT437412 hsa-miR-608 Luciferase reporter assay, Microarray, qRT-PCR 23796562
MIRT437473 rno-miR-19a-3p Luciferase reporter assay 24117217
MIRT437473 rno-miR-19a-3p Luciferase reporter assay 24117217
MIRT437474 rno-miR-19b-3p Luciferase reporter assay 24117217
Transcription factors
Transcription factor Regulation Reference
EZH2 Repression 21546904
EZH2 Unknown 24213577
SMAD4 Unknown 20065949
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 18354498
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606604 16731 ENSG00000156804
Protein
UniProt ID Q969P5
Protein name F-box only protein 32 (Atrogin-1) (Muscle atrophy F-box protein) (MAFbx)
Protein function Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated t
Family and domains
Tissue specificity TISSUE SPECIFICITY: Specifically expressed in cardiac and skeletal muscle.
Sequence
MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVA
AKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN
YVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTL
VQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRL
SDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
VRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF
Sequence length 355
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  FoxO signaling pathway   Neddylation
Antigen processing: Ubiquitination & Proteasome degradation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Glaucoma Glaucoma N/A N/A GWAS
Myopathy dilated cardiomyopathy N/A N/A GenCC
Neuroblastoma Neuroblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Stimulate 29129636
Atrophy Associate 15100091, 16916907, 18240972, 22518834, 27526027, 28947926, 37335026
Breast Neoplasms Associate 17437993, 34197655
Burns Stimulate 23816995
Carcinogenesis Inhibit 32516567
Carcinoma Pancreatic Ductal Stimulate 35046938
Cardiomyopathy Dilated Associate 26753747, 36344977
Colorectal Neoplasms Associate 29465067
Cryopyrin Associated Periodic Syndromes Stimulate 37380094
Diabetes Mellitus Associate 20966391