Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	114905
Gene name	C1q and TNF related 7
Gene symbol	C1QTNF7
Synonyms (NCBI Gene)	CTRP7ZACRP7
Chromosome	4
Chromosome location	4p15.32

Show/Hide all (66)

miRTarBase ID	miRNA	Experiments
MIRT842423	hsa-miR-2110	CLIP-seq
MIRT842424	hsa-miR-27a	CLIP-seq
MIRT842425	hsa-miR-27b	CLIP-seq
MIRT842426	hsa-miR-296-3p	CLIP-seq
MIRT842427	hsa-miR-300	CLIP-seq
MIRT842428	hsa-miR-3120-5p	CLIP-seq
MIRT842429	hsa-miR-3121-5p	CLIP-seq
MIRT842430	hsa-miR-3150a-3p	CLIP-seq
MIRT842431	hsa-miR-3150b-3p	CLIP-seq
MIRT842432	hsa-miR-3182	CLIP-seq
MIRT842433	hsa-miR-3192	CLIP-seq
MIRT842434	hsa-miR-326	CLIP-seq
MIRT842435	hsa-miR-330-5p	CLIP-seq
MIRT842436	hsa-miR-3663-3p	CLIP-seq
MIRT842437	hsa-miR-381	CLIP-seq
MIRT842438	hsa-miR-412	CLIP-seq
MIRT842439	hsa-miR-4263	CLIP-seq
MIRT842440	hsa-miR-4271	CLIP-seq
MIRT842441	hsa-miR-4314	CLIP-seq
MIRT842442	hsa-miR-4646-5p	CLIP-seq
MIRT842443	hsa-miR-4658	CLIP-seq
MIRT842444	hsa-miR-4666-3p	CLIP-seq
MIRT842445	hsa-miR-4689	CLIP-seq
MIRT842446	hsa-miR-4699-5p	CLIP-seq
MIRT842447	hsa-miR-4725-3p	CLIP-seq
MIRT842448	hsa-miR-4747-5p	CLIP-seq
MIRT842449	hsa-miR-4758-5p	CLIP-seq
MIRT842450	hsa-miR-4765	CLIP-seq
MIRT842451	hsa-miR-4784	CLIP-seq
MIRT842452	hsa-miR-513a-5p	CLIP-seq
MIRT842453	hsa-miR-576-5p	CLIP-seq
MIRT842454	hsa-miR-626	CLIP-seq
MIRT842455	hsa-miR-653	CLIP-seq
MIRT842456	hsa-miR-1321	CLIP-seq
MIRT842457	hsa-miR-2964a-3p	CLIP-seq
MIRT842429	hsa-miR-3121-5p	CLIP-seq
MIRT842458	hsa-miR-3185	CLIP-seq
MIRT842459	hsa-miR-3199	CLIP-seq
MIRT842460	hsa-miR-3689d	CLIP-seq
MIRT842439	hsa-miR-4263	CLIP-seq
MIRT842461	hsa-miR-4276	CLIP-seq
MIRT842462	hsa-miR-4475	CLIP-seq
MIRT842463	hsa-miR-4481	CLIP-seq
MIRT842464	hsa-miR-4648	CLIP-seq
MIRT842465	hsa-miR-4720-3p	CLIP-seq
MIRT842466	hsa-miR-4739	CLIP-seq
MIRT842467	hsa-miR-4745-5p	CLIP-seq
MIRT842468	hsa-miR-4756-5p	CLIP-seq
MIRT842469	hsa-miR-4804-3p	CLIP-seq
MIRT842453	hsa-miR-576-5p	CLIP-seq
MIRT842470	hsa-miR-624	CLIP-seq
MIRT842454	hsa-miR-626	CLIP-seq
MIRT842458	hsa-miR-3185	CLIP-seq
MIRT842461	hsa-miR-4276	CLIP-seq
MIRT842465	hsa-miR-4720-3p	CLIP-seq
MIRT842469	hsa-miR-4804-3p	CLIP-seq
MIRT2187677	hsa-miR-1913	CLIP-seq
MIRT842428	hsa-miR-3120-5p	CLIP-seq
MIRT842433	hsa-miR-3192	CLIP-seq
MIRT2187678	hsa-miR-324-3p	CLIP-seq
MIRT842436	hsa-miR-3663-3p	CLIP-seq
MIRT842441	hsa-miR-4314	CLIP-seq
MIRT2187679	hsa-miR-4632	CLIP-seq
MIRT842442	hsa-miR-4646-5p	CLIP-seq
MIRT842448	hsa-miR-4747-5p	CLIP-seq
MIRT2187680	hsa-miR-4749-3p	CLIP-seq

Show/Hide all (4)

GO ID	Ontology	Definition	Evidence
GO:0005576	Component	Extracellular region	IEA
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IEA
GO:0042802	Function	Identical protein binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9BXJ2

Protein name

Complement C1q tumor necrosis factor-related protein 7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01391	Collagen	36 → 94	Collagen triple helix repeat (20 copies)	Repeat
PF01391	Collagen	80 → 139	Collagen triple helix repeat (20 copies)	Repeat
PF00386	C1q	149 → 273	C1q domain	Domain

Sequence

MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGL
PGRDGRDGRKGEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGP
PGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNP
ATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQ
PEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL

Sequence length

289

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BELL'S PALSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Conduct Disorder	Associate	20585324	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Inhibit	26301107	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Associate	39372720	★★★★★ ★☆☆☆☆ Found in Text Mining only

C1QTNF7 (C1q and TNF related 7)