Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	114814
Gene name Gene Name - the full gene name approved by the HGNC.	Gonadotropin releasing hormone receptor 2 (pseudogene)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GNRHR2
Synonyms (NCBI Gene) Gene synonyms aliases	GNRHR2P, GnRH-II-R
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q21.1
Summary Summary of gene provided in NCBI Entrez Gene.	In non-hominoid primates and non-mammalian vertebrates, the gonadotropin releasing hormone 2 receptor gene (GnRHR2) encodes a seven-transmembrane G-protein coupled receptor. However, in human, the corresponding reading frame contains a premature stop codo

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004968	Function	Gonadotropin-releasing hormone receptor activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0016500	Function	Protein-hormone receptor activity	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0097211	Process	Cellular response to gonadotropin-releasing hormone	IEA

MIM	HGNC	e!Ensembl
612875	16341	ENSG00000293505

Protein

UniProt ID

Q96P88

Protein name

Putative gonadotropin-releasing hormone II receptor (GnRH II receptor) (GnRH-II-R) (Type II GnRH receptor)

Protein function

Putative receptor for gonadotropin releasing hormone II (GnRH II) which is most probably non-functional.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	6 → 233	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in many tissues. {ECO:0000269|PubMed:11861490}.

Sequence

MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLG
SRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFT
FCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLAL
LILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGC
RRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI

Sequence length

292

Interactions

View interactions

GNRHR2 (gonadotropin releasing hormone receptor 2 (pseudogene))