GNRHR2 (gonadotropin releasing hormone receptor 2 (pseudogene))

Gene

• Entrez ID: 114814
• Gene name: Gonadotropin releasing hormone receptor 2 (pseudogene)
• Gene symbol: GNRHR2
• Synonyms (NCBI Gene): GNRHR2P, GnRH-II-R
• Chromosome: 1
• Chromosome location: 1q21.1
• Summary: In non-hominoid primates and non-mammalian vertebrates, the gonadotropin releasing hormone 2 receptor gene (GnRHR2) encodes a seven-transmembrane G-protein coupled receptor. However, in human, the corresponding reading frame contains a premature stop codo

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004968	Function	Gonadotropin-releasing hormone receptor activity	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0016500	Function	Protein-hormone receptor activity	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0097211	Process	Cellular response to gonadotropin-releasing hormone	IEA

Other IDs

• MIM: 612875
• HGNC: 16341
• e!Ensembl: ENSG00000293505

Protein

• UniProt ID: Q96P88
• Protein name: Putative gonadotropin-releasing hormone II receptor (GnRH II receptor) (GnRH-II-R) (Type II GnRH receptor)
• Protein function: Putative receptor for gonadotropin releasing hormone II (GnRH II) which is most probably non-functional.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	6 → 233	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in many tissues. {ECO:0000269|PubMed:11861490}.
• Sequence:

  MSAGNGTPWDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLG
  SRSGVRKLLGAAWGLSFLLAFPQLFLFHTVHCAGPVPFTQCVTKGSFKAQWQETTYNLFT
  FCCLFLLPLTAMAICYSRIVLSVSRPQTRKGSHAPAGEFALPRSFDNCPRVRLRALRLAL
  LILLTFILCWTPYYLLGMWYWFSPTMLTEVPPSLSHILFLLGLLNAPLDPLLYGAFTLGC
  RRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI

• Sequence length: 292