Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	114771
Gene name	Peptidoglycan recognition protein 3
Gene symbol	PGLYRP3
Synonyms (NCBI Gene)	PGLYRPIalphaPGRP-IalphaPGRPIA
Chromosome	1
Chromosome location	1q21.3
Summary	This gene encodes a peptidoglycan recognition protein, which belongs to the N-acetylmuramoyl-L-alanine amidase 2 family. These proteins are part of the innate immune system and recognize peptidoglycan, a ubiquitous component of bacterial cell walls. This

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006955	Process	Immune response	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008745	Function	N-acetylmuramoyl-L-alanine amidase activity	IEA
GO:0009253	Process	Peptidoglycan catabolic process	IEA
GO:0016019	Function	Peptidoglycan immune receptor activity	IDA	11461926
GO:0016019	Function	Peptidoglycan immune receptor activity	IEA
GO:0016020	Component	Membrane	NAS	11461926
GO:0016045	Process	Detection of bacterium	IDA	11461926
GO:0016045	Process	Detection of bacterium	IEA
GO:0031640	Process	Killing of cells of another organism	IDA	16354652
GO:0031640	Process	Killing of cells of another organism	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032827	Process	Negative regulation of natural killer cell differentiation involved in immune response	IEA
GO:0032991	Component	Protein-containing complex	IDA	16354652
GO:0042742	Process	Defense response to bacterium	IBA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042834	Function	Peptidoglycan binding	IDA	11461926, 16354652, 17502600
GO:0042834	Function	Peptidoglycan binding	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	NAS	11461926
GO:0046982	Function	Protein heterodimerization activity	IPI	16354652
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	11461926, 16354652
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051701	Process	Biological process involved in interaction with host	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	16354652
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IEA

MIM	HGNC	e!Ensembl
608197	30014	ENSG00000159527

Q96LB9

Protein name

Peptidoglycan recognition protein 3 (Peptidoglycan recognition protein I-alpha) (PGLYRPIalpha) (PGRP-I-alpha) (Peptidoglycan recognition protein intermediate alpha)

Protein function

Pattern receptor that binds to murein peptidoglycans (PGN) of Gram-positive bacteria. Has bactericidal activity towards Gram-positive bacteria. May kill Gram-positive bacteria by interfering with peptidoglycan biosynthesis. Also binds to Gram-ne

PDB

1SK3 , 1SK4 , 1TWQ , 2APH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01510	Amidase_2	46 → 181	N-acetylmuramoyl-L-alanine amidase	Domain
PF01510	Amidase_2	197 → 327	N-acetylmuramoyl-L-alanine amidase	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in skin epidermis, eccrine sweat glands and ducts, ciliary body epithelial cells of the eye, in small intestine, colon, stomach and in mature epithelial cells of the tongue (at protein level). Highly expressed in skin and esop

Sequence

MGTLPWLLAFFILGLQAWDTPTIVSRKEWGARPLACRALLTLPVAYIITDQLPGMQCQQQ
SVCSQMLRGLQSHSVYTIGWCDVAYNFLVGDDGRVYEGVGWNIQGLHTQGYNNISLGIAF
FGNKIGSSPSPAALSAAEGLISYAIQKGHLSPRYIQPLLLKEETCLDPQHPVMPRKVCPN
IIKRSAWEARETHCPKMNLPAKYVIIIHTAGTSCTVSTDCQTVVRNIQSFHMDTRNFCDI
GYHFLVGQDGGVYEGVGWHIQGSHTYGFNDIALGIAFIGYFVEKPPNAAALEAAQDLIQC
AVVEGYLTPNYLLMGHSDVVNILSPGQALYNIISTWPHFKH

Sequence length

341

Interactions

View interactions

	Reactome
			Antimicrobial peptides

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PGLYRP3-associated inflamatory bowel disease	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Esophageal Neoplasms	Associate	36588538	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Associate	24838182	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	35909123	★★★★★ ★☆☆☆☆ Found in Text Mining only

PGLYRP3 (peptidoglycan recognition protein 3)