Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
114757
Gene name Gene Name - the full gene name approved by the HGNC.
Cytoglobin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CYGB
Synonyms (NCBI Gene) Gene synonyms aliases
HGB, NOD, STAP
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protecti
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016773 hsa-miR-335-5p Microarray 18185580
MIRT504681 hsa-miR-5011-5p PAR-CLIP 21572407
MIRT504680 hsa-miR-511-3p PAR-CLIP 21572407
MIRT504679 hsa-miR-190a-5p PAR-CLIP 21572407
MIRT504678 hsa-miR-190b PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004601 Function Peroxidase activity ISS 11320098
GO:0005344 Function Oxygen carrier activity NAS 11919282
GO:0005506 Function Iron ion binding IEA
GO:0005515 Function Protein binding IPI 25416956, 28536627, 32296183
GO:0005829 Component Cytosol TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
608759 16505 ENSG00000161544
Protein
UniProt ID Q8WWM9
Protein name Cytoglobin (Histoglobin) (HGb) (Nitric oxygen dioxygenase CYGB) (NOD) (EC 1.14.12.-) (Nitrite reductase CYGB) (EC 1.7.-.-) (Pseudoperoxidase CYGB) (EC 1.11.1.-) (Stellate cell activation-associated protein) (Superoxide dismutase CYGB) (EC 1.15.1.1)
Protein function Probable multifunctional globin with a hexacoordinated heme iron required for the catalysis of various reactions depending on redox condition of the cell as well as oxygen availability (PubMed:11893755, PubMed:12359339, PubMed:15165856, PubMed:1
PDB 1UMO , 1URV , 1URY , 1UT0 , 1UX9 , 1V5H , 2DC3 , 3AG0 , 4B3W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00042 Globin 23 132 Globin Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Highest expression in heart, stomach, bladder and small intestine. {ECO:0000269|PubMed:11893755, ECO:0000269|PubMed:11919282, ECO:0000269|PubMed:14660570}.
Sequence
MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYF
SQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVE
PVYFKILSGVIL
EVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT
PPATLPSSGP
Sequence length 190
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    eNOS activation
Intracellular oxygen transport
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cholestasis Cholestasis, Extrahepatic rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039 30026087
Retinitis pigmentosa Retinitis Pigmentosa, RETINITIS PIGMENTOSA 36 rs267606794, rs200691042, rs397704718, rs202193201, rs267606793, rs2147483647, rs779886453, rs267606691, rs794728002, rs878853253, rs137853189, rs137853190, rs137853112, rs137853113, rs137853114
View all (1830 more)
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 27431913
Barrett Esophagus Associate 27431913
Breast Neoplasms Associate 18373244, 18794132, 25774687
Chemical and Drug Induced Liver Injury Associate 28916723, 32330605
Colorectal Neoplasms Associate 33611811
Fatty Liver Alcoholic Associate 32330605
Fibrosis Associate 28916723, 30992080, 34035373
Glaucoma Associate 30992080
Glioma Associate 23688241
Head and Neck Neoplasms Associate 19568272, 21063414