Gene Gene information from NCBI Gene database.
Entrez ID 114609
Gene name TIR domain containing adaptor protein
Gene symbol TIRAP
Synonyms (NCBI Gene)
BACTS1MalMyD88-2wyatt
Chromosome 11
Chromosome location 11q24.2
Summary The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleuk
miRNA miRNA information provided by mirtarbase database.
256
miRTarBase ID miRNA Experiments Reference
MIRT004748 hsa-miR-145-5p ImmunoprecipitaionWestern blotCommunoprecipitaion 19898489
MIRT674506 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT674505 hsa-miR-764 HITS-CLIP 23824327
MIRT674504 hsa-miR-3934-5p HITS-CLIP 23824327
MIRT674503 hsa-miR-4635 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
63
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0002755 Process MyD88-dependent toll-like receptor signaling pathway TAS 19509286
GO:0005080 Function Protein kinase C binding IPI 17161867
GO:0005515 Function Protein binding IPI 11544529, 17258210, 17360653, 17583698, 19509286, 19574958, 19948740, 21334391, 21829704, 21903422, 22155231, 24275656, 33961781
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding ISS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606252 17192 ENSG00000150455
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P58753
Protein name Toll/interleukin-1 receptor domain-containing adapter protein (TIR domain-containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter-like protein) (MyD88-2)
Protein function Adapter involved in TLR2, TLR4 and RAGE signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response
PDB 2NDH , 2Y92 , 3UB2 , 3UB3 , 3UB4 , 4FZ5 , 4LQD , 5T7Q , 5UZB , 8JZM
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13676 TIR_2 88 211 TIR domain Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain.
Sequence
MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPS
LSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAAQDLVSYLEGSTASLRCFLQL
RDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPWCKYQMLQALTEAPGAEGCTIPLLS
GLSRAAYPPELRFMYYVDGRGPDGGFRQVKE
AVMRYLQTLS
Sequence length 221
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  NF-kappa B signaling pathway
Toll-like receptor signaling pathway
Alcoholic liver disease
Pathogenic Escherichia coli infection
Salmonella infection
Pertussis
Tuberculosis
Hepatitis B
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis
  ER-Phagosome pathway
MyD88:MAL(TIRAP) cascade initiated on plasma membrane
MyD88 deficiency (TLR2/4)
IRAK4 deficiency (TLR2/4)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
12
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Bacteremia, susceptibility Benign rs8177374 RCV000023527
Bacteremia, susceptibility to, 1 Benign rs8177374 RCV002490312
Invasive pneumococcal disease, protection against Benign rs8177374 RCV000004722
Malaria, resistance to Benign rs8177374 RCV000004723
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Lung Injury Associate 21118491
Arthritis Rheumatoid Associate 17255320
Bacteremia Associate 19602285
Breast Neoplasms Associate 35233921
Carcinoma Non Small Cell Lung Associate 31207932
Chagas Cardiomyopathy Associate 24330528
Communicable Diseases Associate 19602285
Coronary Disease Associate 29121163
COVID 19 Associate 34995294
Dermatitis Atopic Associate 21399862