Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1142
Gene name Gene Name - the full gene name approved by the HGNC.	Cholinergic receptor nicotinic beta 3 subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CHRNB3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are (hetero)pentamers composed of homologous subunits. The subunits that make up the mus

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments
MIRT892058	hsa-miR-1207-5p	CLIP-seq
MIRT892059	hsa-miR-1231	CLIP-seq
MIRT892060	hsa-miR-1909	CLIP-seq
MIRT892061	hsa-miR-3153	CLIP-seq
MIRT892062	hsa-miR-3192	CLIP-seq
MIRT892063	hsa-miR-3714	CLIP-seq
MIRT892064	hsa-miR-4314	CLIP-seq
MIRT892065	hsa-miR-4646-5p	CLIP-seq
MIRT892066	hsa-miR-4668-5p	CLIP-seq
MIRT892067	hsa-miR-4763-3p	CLIP-seq
MIRT892068	hsa-miR-940	CLIP-seq
MIRT1964368	hsa-miR-4719	CLIP-seq
MIRT2200492	hsa-miR-4639-3p	CLIP-seq
MIRT2200493	hsa-miR-4645-5p	CLIP-seq
MIRT2200494	hsa-miR-4660	CLIP-seq
MIRT2200495	hsa-miR-4673	CLIP-seq
MIRT2200496	hsa-miR-646	CLIP-seq
MIRT2386071	hsa-miR-2113	CLIP-seq
MIRT2386072	hsa-miR-562	CLIP-seq

Show/Hide all(43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005892	Component	Acetylcholine-gated channel complex	IBA
GO:0005892	Component	Acetylcholine-gated channel complex	IDA	11118490, 16835356
GO:0005892	Component	Acetylcholine-gated channel complex	IEA
GO:0005892	Component	Acetylcholine-gated channel complex	TAS	7690916
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007165	Process	Signal transduction	TAS	7690916
GO:0007271	Process	Synaptic transmission, cholinergic	IBA
GO:0007271	Process	Synaptic transmission, cholinergic	TAS	7690916
GO:0007274	Process	Neuromuscular synaptic transmission	IBA
GO:0015267	Function	Channel activity	TAS	7690916
GO:0015464	Function	Acetylcholine receptor activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	8906617
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	IBA
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	IEA
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	TAS	7690916
GO:0032991	Component	Protein-containing complex	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034703	Component	Cation channel complex	IDA	11118490, 16835356
GO:0035094	Process	Response to nicotine	IBA
GO:0042166	Function	Acetylcholine binding	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051899	Process	Membrane depolarization	IBA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0095500	Process	Acetylcholine receptor signaling pathway	IBA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098691	Component	Dopaminergic synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098878	Component	Neurotransmitter receptor complex	IDA	11118490, 16835356
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IBA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1901363	Function	Heterocyclic compound binding	IEA

MIM	HGNC	e!Ensembl
118508	1963	ENSG00000147432

Protein

UniProt ID

Q05901

Protein name

Neuronal acetylcholine receptor subunit beta-3

Protein function

Component of neuronal acetylcholine receptors (nAChRs) that function as pentameric, ligand-gated cation channels with high calcium permeability among other activities. nAChRs are excitatory neurotrasnmitter receptors formed by a collection of nA

PDB

8A5U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	29 → 233	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	240 → 387	Neurotransmitter-gated ion-channel transmembrane region	Family
PF02932	Neur_chan_memb	355 → 446	Neurotransmitter-gated ion-channel transmembrane region	Family

Sequence

MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGL
KISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFEN
ADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTM
VDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFL
IIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYL
LFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPE
KEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH

Sequence length

458

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Highly calcium permeable postsynaptic nicotinic acetylcholine receptors Highly calcium permeable nicotinic acetylcholine receptors

CHRNB3 (cholinergic receptor nicotinic beta 3 subunit)