Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1142
Gene name Gene Name - the full gene name approved by the HGNC.	Cholinergic receptor nicotinic beta 3 subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CHRNB3
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8p11.21
Summary Summary of gene provided in NCBI Entrez Gene.	The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are (hetero)pentamers composed of homologous subunits. The subunits that make up the mus

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments
MIRT892058	hsa-miR-1207-5p	CLIP-seq
MIRT892059	hsa-miR-1231	CLIP-seq
MIRT892060	hsa-miR-1909	CLIP-seq
MIRT892061	hsa-miR-3153	CLIP-seq
MIRT892062	hsa-miR-3192	CLIP-seq
MIRT892063	hsa-miR-3714	CLIP-seq
MIRT892064	hsa-miR-4314	CLIP-seq
MIRT892065	hsa-miR-4646-5p	CLIP-seq
MIRT892066	hsa-miR-4668-5p	CLIP-seq
MIRT892067	hsa-miR-4763-3p	CLIP-seq
MIRT892068	hsa-miR-940	CLIP-seq
MIRT1964368	hsa-miR-4719	CLIP-seq
MIRT2200492	hsa-miR-4639-3p	CLIP-seq
MIRT2200493	hsa-miR-4645-5p	CLIP-seq
MIRT2200494	hsa-miR-4660	CLIP-seq
MIRT2200495	hsa-miR-4673	CLIP-seq
MIRT2200496	hsa-miR-646	CLIP-seq
MIRT2386071	hsa-miR-2113	CLIP-seq
MIRT2386072	hsa-miR-562	CLIP-seq

Show/Hide all(20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005892	Component	Acetylcholine-gated channel complex	IEA
GO:0007165	Process	Signal transduction	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007271	Process	Synaptic transmission, cholinergic	IBA	21873635
GO:0015267	Function	Channel activity	TAS	7690916
GO:0015464	Function	Acetylcholine receptor activity	IBA	21873635
GO:0016021	Component	Integral component of membrane	NAS	8906617
GO:0022848	Function	Acetylcholine-gated cation-selective channel activity	IEA
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0034220	Process	Ion transmembrane transport	IBA	21873635
GO:0035094	Process	Response to nicotine	IBA	21873635
GO:0042166	Function	Acetylcholine binding	IEA
GO:0042391	Process	Regulation of membrane potential	IBA	21873635
GO:0043005	Component	Neuron projection	IBA	21873635
GO:0045202	Component	Synapse	IBA	21873635
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0050877	Process	Nervous system process	IBA	21873635
GO:0060079	Process	Excitatory postsynaptic potential	IEA

MIM	HGNC	e!Ensembl
118508	1963	ENSG00000147432

Protein

UniProt ID

Q05901

Protein name

Neuronal acetylcholine receptor subunit beta-3

Protein function

Component of neuronal acetylcholine receptors (nAChRs) that function as pentameric, ligand-gated cation channels with high calcium permeability among other activities. nAChRs are excitatory neurotrasnmitter receptors formed by a collection of nA

PDB

8A5U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	29 → 233	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	240 → 387	Neurotransmitter-gated ion-channel transmembrane region	Family
PF02932	Neur_chan_memb	355 → 446	Neurotransmitter-gated ion-channel transmembrane region	Family

Sequence

MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGL
KISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFEN
ADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTM
VDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFL
IIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYL
LFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPE
KEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH

Sequence length

458

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction		Highly calcium permeable postsynaptic nicotinic acetylcholine receptors Highly calcium permeable nicotinic acetylcholine receptors

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder		19204725	ClinVar

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Alcoholism	Associate	28850771
Antisocial Personality Disorder	Associate	27085880
Attention Deficit Disorder with Hyperactivity	Associate	23899432
Bipolar Disorder	Associate	21191315
Cocaine Related Disorders	Associate	24675634
Epilepsy Idiopathic Generalized	Associate	10205274
Intervertebral Disc Degeneration	Associate	35069789
Lung Neoplasms	Associate	25233467
Ovarian Neoplasms	Associate	35618786
Recombinant chromosome 8 syndrome	Associate	35618786
Substance Related Disorders	Associate	27085880
Tobacco Use Disorder	Associate	19500157, 20584212, 28850771

CHRNB3 (cholinergic receptor nicotinic beta 3 subunit)