UCN3 (urocortin 3)

Gene

• Entrez ID: 114131
• Gene name: Urocortin 3
• Gene symbol: UCN3
• Synonyms (NCBI Gene): SCP, SPC, UCNIII
• Chromosome: 10
• Chromosome location: 10p15.1
• Summary: This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family of proteins. The encoded preproprotein is proteolytically processed to generate the mature peptide hormone, which is secreted by pancreatic beta and alpha cells.

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	20966082
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	11329063
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007586	Process	Digestion	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	11329063
GO:0030424	Component	Axon	IEA
GO:0031669	Process	Cellular response to nutrient levels	IBA
GO:0031669	Process	Cellular response to nutrient levels	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0035902	Process	Response to immobilization stress	IEA
GO:0042594	Process	Response to starvation	IEA
GO:0043196	Component	Varicosity	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0045838	Process	Positive regulation of membrane potential	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IBA
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IPI	11329063
GO:0051431	Function	Corticotropin-releasing hormone receptor 2 binding	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA

Other IDs

• MIM: 605901
• HGNC: 17781
• e!Ensembl: ENSG00000178473

Protein

• UniProt ID: Q969E3
• Protein name: Urocortin-3 (Stresscopin) (Urocortin III) (Ucn III)
• Protein function: Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
• PDB: 2RMH, 3N93
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00473	CRF	120 → 157	Corticotropin-releasing factor family	Family

• Sequence:

  MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFH
  YLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKF
  TLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK

• Sequence length: 161

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Class B/2 (Secretin family receptors)