Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	114131
Gene name Gene Name - the full gene name approved by the HGNC.	Urocortin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UCN3
Synonyms (NCBI Gene) Gene synonyms aliases	SCP, SPC, UCNIII
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10p15.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family of proteins. The encoded preproprotein is proteolytically processed to generate the mature peptide hormone, which is secreted by pancreatic beta and alpha cells.

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005179	Function	Hormone activity	IEA
GO:0005515	Function	Protein binding	IPI	20966082
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	11329063
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007586	Process	Digestion	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	11329063
GO:0030424	Component	Axon	IEA
GO:0031669	Process	Cellular response to nutrient levels	IBA
GO:0031669	Process	Cellular response to nutrient levels	IEA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0035902	Process	Response to immobilization stress	IEA
GO:0042594	Process	Response to starvation	IEA
GO:0043196	Component	Varicosity	IEA
GO:0043679	Component	Axon terminus	IEA
GO:0045838	Process	Positive regulation of membrane potential	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IBA
GO:0051429	Function	Corticotropin-releasing hormone receptor binding	IPI	11329063
GO:0051431	Function	Corticotropin-releasing hormone receptor 2 binding	IEA
GO:0071456	Process	Cellular response to hypoxia	IEA

MIM	HGNC	e!Ensembl
605901	17781	ENSG00000178473

Protein

UniProt ID

Q969E3

Protein name

Urocortin-3 (Stresscopin) (Urocortin III) (Ucn III)

Protein function

Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.

PDB

2RMH , 3N93

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00473	CRF	120 → 157	Corticotropin-releasing factor family	Family

Sequence

MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFH
YLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKF
TLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK

Sequence length

161

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Class B/2 (Secretin family receptors)

UCN3 (urocortin 3)