UCN3 (urocortin 3)

Gene
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
114131
Gene name Gene Name - the full gene name approved by the HGNC.
Urocortin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
UCN3
Synonyms (NCBI Gene) Gene synonyms aliases
SCP, SPC, UCNIII
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p15.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the sauvagine/corticotropin-releasing factor/urotensin I family of proteins. The encoded preproprotein is proteolytically processed to generate the mature peptide hormone, which is secreted by pancreatic beta and alpha cells.
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(21)
GO ID Ontology Definition Evidence Reference
GO:0005179 Function Hormone activity IEA
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0007189 Process Adenylate cyclase-activating G protein-coupled receptor signaling pathway IBA 21873635
GO:0007189 Process Adenylate cyclase-activating G protein-coupled receptor signaling pathway IDA 11329063
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605901 17781 ENSG00000178473
Protein
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q969E3
Protein name Urocortin-3 (Stresscopin) (Urocortin III) (Ucn III)
Protein function Suppresses food intake, delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress.
PDB 2RMH , 3N93
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00473 CRF 120 → 157 Corticotropin-releasing factor family Family
Sequence 
MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFH
YLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKF
TLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK
Sequence length 161
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Neuroactive ligand-receptor interaction
Hormone signaling 		  Class B/2 (Secretin family receptors)
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Mental depression Unipolar Depression, Major Depressive Disorder 18045927 ClinVar
Show/Hide Text Mining Associations (13)
Associations from Text Mining
Disease Name Relationship Type References
Adenoma Associate 21908929
COVID 19 Associate 33173052
Depressive Disorder Major Associate 18045927
Diabetes Mellitus Type 1 Associate 36201618
Diabetes Mellitus Type 2 Associate 30372580, 36942376
Heart Failure Associate 27754786
Lung Injury Associate 33173052
Neoplasm Metastasis Stimulate 35638427
Neoplasms Associate 35638427
Obesity Inhibit 35276788