Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1140
Gene name Gene Name - the full gene name approved by the HGNC.	Cholinergic receptor nicotinic beta 1 subunit
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CHRNB1
Synonyms (NCBI Gene) Gene synonyms aliases	ACHRB, CHRNB, CMS1D, CMS2A, CMS2C, SCCMS
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.	The muscle acetylcholine receptor is composed of five subunits: two alpha subunits and one beta, one gamma, and one delta subunit. This gene encodes the beta subunit of the acetylcholine receptor. The acetylcholine receptor changes conformation upon acety

Show/Hide all(11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs75019736	G>A	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Synonymous variant, coding sequence variant
rs137852810	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs137852811	C>A	Pathogenic	Coding sequence variant, missense variant
rs199875082	C>A,T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs201033437	C>G,T	Pathogenic, uncertain-significance	Synonymous variant, stop gained, coding sequence variant
rs766823872	G>A	Pathogenic	Coding sequence variant, stop gained
rs781689096	CTC>-	Conflicting-interpretations-of-pathogenicity	Intron variant
rs886041490	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1131691957	GATTC>ACG	Pathogenic	Frameshift variant, coding sequence variant
rs1555552004	TC>-	Pathogenic	Frameshift variant, coding sequence variant
rs1597749210	G>A	Likely-pathogenic	Splice acceptor variant

Show/Hide all(411)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004951	hsa-miR-98-5p	qRT-PCR	17942906
MIRT695097	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT695096	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT695095	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT695094	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT695093	hsa-miR-4794	HITS-CLIP	23313552
MIRT695092	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT695091	hsa-miR-4775	HITS-CLIP	23313552
MIRT695090	hsa-miR-3149	HITS-CLIP	23313552
MIRT695089	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT530683	hsa-miR-4524b-3p	PAR-CLIP	21572407
MIRT530682	hsa-miR-1182	PAR-CLIP	21572407
MIRT530681	hsa-miR-4781-3p	PAR-CLIP	21572407
MIRT530680	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT530679	hsa-miR-3663-5p	PAR-CLIP	21572407
MIRT530678	hsa-miR-4524a-3p	PAR-CLIP	21572407
MIRT530677	hsa-miR-6131	PAR-CLIP	21572407
MIRT530676	hsa-miR-6501-5p	PAR-CLIP	21572407
MIRT530675	hsa-miR-4423-5p	PAR-CLIP	21572407
MIRT530674	hsa-miR-6843-3p	PAR-CLIP	21572407
MIRT530673	hsa-miR-6848-3p	PAR-CLIP	21572407
MIRT530672	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT530671	hsa-miR-1303	PAR-CLIP	21572407
MIRT530683	hsa-miR-4524b-3p	PAR-CLIP	21572407
MIRT530682	hsa-miR-1182	PAR-CLIP	21572407
MIRT530681	hsa-miR-4781-3p	PAR-CLIP	21572407
MIRT530680	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT530678	hsa-miR-4524a-3p	PAR-CLIP	21572407
MIRT530676	hsa-miR-6501-5p	PAR-CLIP	21572407
MIRT530675	hsa-miR-4423-5p	PAR-CLIP	21572407
MIRT530672	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT530671	hsa-miR-1303	PAR-CLIP	21572407
MIRT530683	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT530682	hsa-miR-1182	PAR-CLIP	22012620
MIRT530681	hsa-miR-4781-3p	PAR-CLIP	22012620
MIRT530680	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT530679	hsa-miR-3663-5p	PAR-CLIP	22012620
MIRT530678	hsa-miR-4524a-3p	PAR-CLIP	22012620
MIRT530677	hsa-miR-6131	PAR-CLIP	22012620
MIRT530676	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT530675	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT530674	hsa-miR-6843-3p	PAR-CLIP	22012620
MIRT530673	hsa-miR-6848-3p	PAR-CLIP	22012620
MIRT530672	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT530671	hsa-miR-1303	PAR-CLIP	22012620
MIRT695097	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT695096	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT695095	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT695094	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT695093	hsa-miR-4794	HITS-CLIP	23313552
MIRT695092	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT695091	hsa-miR-4775	HITS-CLIP	23313552
MIRT695090	hsa-miR-3149	HITS-CLIP	23313552
MIRT695089	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT530683	hsa-miR-4524b-3p	PAR-CLIP	21572407
MIRT530682	hsa-miR-1182	PAR-CLIP	21572407
MIRT530681	hsa-miR-4781-3p	PAR-CLIP	21572407
MIRT530680	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT530679	hsa-miR-3663-5p	PAR-CLIP	21572407
MIRT530678	hsa-miR-4524a-3p	PAR-CLIP	21572407
MIRT530677	hsa-miR-6131	PAR-CLIP	21572407
MIRT530676	hsa-miR-6501-5p	PAR-CLIP	21572407
MIRT530675	hsa-miR-4423-5p	PAR-CLIP	21572407
MIRT530674	hsa-miR-6843-3p	PAR-CLIP	21572407
MIRT530673	hsa-miR-6848-3p	PAR-CLIP	21572407
MIRT530672	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT530671	hsa-miR-1303	PAR-CLIP	21572407
MIRT530683	hsa-miR-4524b-3p	PAR-CLIP	21572407
MIRT530682	hsa-miR-1182	PAR-CLIP	21572407
MIRT530681	hsa-miR-4781-3p	PAR-CLIP	21572407
MIRT530680	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT530678	hsa-miR-4524a-3p	PAR-CLIP	21572407
MIRT530676	hsa-miR-6501-5p	PAR-CLIP	21572407
MIRT530675	hsa-miR-4423-5p	PAR-CLIP	21572407
MIRT530672	hsa-miR-744-3p	PAR-CLIP	21572407
MIRT530671	hsa-miR-1303	PAR-CLIP	21572407
MIRT530683	hsa-miR-4524b-3p	PAR-CLIP	22012620
MIRT530682	hsa-miR-1182	PAR-CLIP	22012620
MIRT530681	hsa-miR-4781-3p	PAR-CLIP	22012620
MIRT530680	hsa-miR-1304-3p	PAR-CLIP	22012620
MIRT530679	hsa-miR-3663-5p	PAR-CLIP	22012620
MIRT530678	hsa-miR-4524a-3p	PAR-CLIP	22012620
MIRT530677	hsa-miR-6131	PAR-CLIP	22012620
MIRT530676	hsa-miR-6501-5p	PAR-CLIP	22012620
MIRT530675	hsa-miR-4423-5p	PAR-CLIP	22012620
MIRT530674	hsa-miR-6843-3p	PAR-CLIP	22012620
MIRT530673	hsa-miR-6848-3p	PAR-CLIP	22012620
MIRT530672	hsa-miR-744-3p	PAR-CLIP	22012620
MIRT530671	hsa-miR-1303	PAR-CLIP	22012620
MIRT891927	hsa-miR-106a	CLIP-seq
MIRT891928	hsa-miR-106b	CLIP-seq
MIRT891929	hsa-miR-122	CLIP-seq
MIRT891930	hsa-miR-125a-3p	CLIP-seq
MIRT891931	hsa-miR-1273f	CLIP-seq
MIRT891932	hsa-miR-129-5p	CLIP-seq
MIRT891933	hsa-miR-130a	CLIP-seq
MIRT891934	hsa-miR-130b	CLIP-seq
MIRT891935	hsa-miR-136	CLIP-seq
MIRT891936	hsa-miR-143	CLIP-seq
MIRT891937	hsa-miR-150	CLIP-seq
MIRT891938	hsa-miR-17	CLIP-seq
MIRT891939	hsa-miR-20a	CLIP-seq
MIRT891940	hsa-miR-20b	CLIP-seq
MIRT891941	hsa-miR-301a	CLIP-seq
MIRT891942	hsa-miR-301b	CLIP-seq
MIRT891943	hsa-miR-302a	CLIP-seq
MIRT891944	hsa-miR-302b	CLIP-seq
MIRT891945	hsa-miR-302c	CLIP-seq
MIRT891946	hsa-miR-302d	CLIP-seq
MIRT891947	hsa-miR-302e	CLIP-seq
MIRT891948	hsa-miR-3135b	CLIP-seq
MIRT891949	hsa-miR-3652	CLIP-seq
MIRT891950	hsa-miR-3666	CLIP-seq
MIRT891951	hsa-miR-371-5p	CLIP-seq
MIRT891952	hsa-miR-371b-5p	CLIP-seq
MIRT891953	hsa-miR-372	CLIP-seq
MIRT891954	hsa-miR-373	CLIP-seq
MIRT891955	hsa-miR-3934	CLIP-seq
MIRT891956	hsa-miR-3944-3p	CLIP-seq
MIRT891957	hsa-miR-4295	CLIP-seq
MIRT891958	hsa-miR-4318	CLIP-seq
MIRT891959	hsa-miR-4430	CLIP-seq
MIRT891960	hsa-miR-4438	CLIP-seq
MIRT891961	hsa-miR-4454	CLIP-seq
MIRT891962	hsa-miR-4492	CLIP-seq
MIRT891963	hsa-miR-4498	CLIP-seq
MIRT891964	hsa-miR-4534	CLIP-seq
MIRT891965	hsa-miR-454	CLIP-seq
MIRT891966	hsa-miR-4653-3p	CLIP-seq
MIRT891967	hsa-miR-4707-3p	CLIP-seq
MIRT891968	hsa-miR-4708-5p	CLIP-seq
MIRT891969	hsa-miR-4716-5p	CLIP-seq
MIRT891970	hsa-miR-4731-5p	CLIP-seq
MIRT891971	hsa-miR-4757-5p	CLIP-seq
MIRT891972	hsa-miR-4770	CLIP-seq
MIRT891973	hsa-miR-5095	CLIP-seq
MIRT891974	hsa-miR-512-3p	CLIP-seq
MIRT891975	hsa-miR-515-5p	CLIP-seq
MIRT891976	hsa-miR-519d	CLIP-seq
MIRT891977	hsa-miR-520a-3p	CLIP-seq
MIRT891978	hsa-miR-520b	CLIP-seq
MIRT891979	hsa-miR-520c-3p	CLIP-seq
MIRT891980	hsa-miR-520d-3p	CLIP-seq
MIRT891981	hsa-miR-520e	CLIP-seq
MIRT891982	hsa-miR-520g	CLIP-seq
MIRT891983	hsa-miR-520h	CLIP-seq
MIRT891984	hsa-miR-548g	CLIP-seq
MIRT891985	hsa-miR-762	CLIP-seq
MIRT891986	hsa-miR-764	CLIP-seq
MIRT891987	hsa-miR-93	CLIP-seq
MIRT891929	hsa-miR-122	CLIP-seq
MIRT891931	hsa-miR-1273f	CLIP-seq
MIRT891932	hsa-miR-129-5p	CLIP-seq
MIRT891933	hsa-miR-130a	CLIP-seq
MIRT891934	hsa-miR-130b	CLIP-seq
MIRT891936	hsa-miR-143	CLIP-seq
MIRT1964334	hsa-miR-1976	CLIP-seq
MIRT891941	hsa-miR-301a	CLIP-seq
MIRT891942	hsa-miR-301b	CLIP-seq
MIRT891948	hsa-miR-3135b	CLIP-seq
MIRT1964335	hsa-miR-325	CLIP-seq
MIRT891949	hsa-miR-3652	CLIP-seq
MIRT891950	hsa-miR-3666	CLIP-seq
MIRT891951	hsa-miR-371-5p	CLIP-seq
MIRT891952	hsa-miR-371b-5p	CLIP-seq
MIRT1964336	hsa-miR-4279	CLIP-seq
MIRT891957	hsa-miR-4295	CLIP-seq
MIRT891959	hsa-miR-4430	CLIP-seq
MIRT891960	hsa-miR-4438	CLIP-seq
MIRT1964337	hsa-miR-4503	CLIP-seq
MIRT891964	hsa-miR-4534	CLIP-seq
MIRT891965	hsa-miR-454	CLIP-seq
MIRT891966	hsa-miR-4653-3p	CLIP-seq
MIRT891968	hsa-miR-4708-5p	CLIP-seq
MIRT1964338	hsa-miR-4722-3p	CLIP-seq
MIRT1964339	hsa-miR-4765	CLIP-seq
MIRT891972	hsa-miR-4770	CLIP-seq
MIRT891973	hsa-miR-5095	CLIP-seq
MIRT891927	hsa-miR-106a	CLIP-seq
MIRT891928	hsa-miR-106b	CLIP-seq
MIRT891929	hsa-miR-122	CLIP-seq
MIRT2200458	hsa-miR-1224-3p	CLIP-seq
MIRT891930	hsa-miR-125a-3p	CLIP-seq
MIRT2200459	hsa-miR-1260	CLIP-seq
MIRT2200460	hsa-miR-1260b	CLIP-seq
MIRT2200461	hsa-miR-1280	CLIP-seq
MIRT891933	hsa-miR-130a	CLIP-seq
MIRT891934	hsa-miR-130b	CLIP-seq
MIRT891935	hsa-miR-136	CLIP-seq
MIRT891937	hsa-miR-150	CLIP-seq
MIRT891938	hsa-miR-17	CLIP-seq
MIRT2200462	hsa-miR-193a-3p	CLIP-seq
MIRT2200463	hsa-miR-193b	CLIP-seq
MIRT1964334	hsa-miR-1976	CLIP-seq
MIRT891939	hsa-miR-20a	CLIP-seq
MIRT891940	hsa-miR-20b	CLIP-seq
MIRT2200464	hsa-miR-224	CLIP-seq
MIRT891941	hsa-miR-301a	CLIP-seq
MIRT891942	hsa-miR-301b	CLIP-seq
MIRT891943	hsa-miR-302a	CLIP-seq
MIRT891944	hsa-miR-302b	CLIP-seq
MIRT891945	hsa-miR-302c	CLIP-seq
MIRT891946	hsa-miR-302d	CLIP-seq
MIRT891947	hsa-miR-302e	CLIP-seq
MIRT891948	hsa-miR-3135b	CLIP-seq
MIRT1964335	hsa-miR-325	CLIP-seq
MIRT891949	hsa-miR-3652	CLIP-seq
MIRT891950	hsa-miR-3666	CLIP-seq
MIRT2200465	hsa-miR-3680	CLIP-seq
MIRT2200466	hsa-miR-3691-3p	CLIP-seq
MIRT891951	hsa-miR-371-5p	CLIP-seq
MIRT891952	hsa-miR-371b-5p	CLIP-seq
MIRT891953	hsa-miR-372	CLIP-seq
MIRT891954	hsa-miR-373	CLIP-seq
MIRT891955	hsa-miR-3934	CLIP-seq
MIRT891956	hsa-miR-3944-3p	CLIP-seq
MIRT2200467	hsa-miR-411	CLIP-seq
MIRT1964336	hsa-miR-4279	CLIP-seq
MIRT891957	hsa-miR-4295	CLIP-seq
MIRT891959	hsa-miR-4430	CLIP-seq
MIRT891960	hsa-miR-4438	CLIP-seq
MIRT2200468	hsa-miR-4444	CLIP-seq
MIRT891961	hsa-miR-4454	CLIP-seq
MIRT2200469	hsa-miR-4480	CLIP-seq
MIRT891962	hsa-miR-4492	CLIP-seq
MIRT891963	hsa-miR-4498	CLIP-seq
MIRT2200470	hsa-miR-4532	CLIP-seq
MIRT891965	hsa-miR-454	CLIP-seq
MIRT891966	hsa-miR-4653-3p	CLIP-seq
MIRT891967	hsa-miR-4707-3p	CLIP-seq
MIRT891969	hsa-miR-4716-5p	CLIP-seq
MIRT1964338	hsa-miR-4722-3p	CLIP-seq
MIRT891970	hsa-miR-4731-5p	CLIP-seq
MIRT891971	hsa-miR-4757-5p	CLIP-seq
MIRT1964339	hsa-miR-4765	CLIP-seq
MIRT2200471	hsa-miR-4772-3p	CLIP-seq
MIRT2200472	hsa-miR-500a	CLIP-seq
MIRT891973	hsa-miR-5095	CLIP-seq
MIRT891974	hsa-miR-512-3p	CLIP-seq
MIRT891975	hsa-miR-515-5p	CLIP-seq
MIRT891976	hsa-miR-519d	CLIP-seq
MIRT891977	hsa-miR-520a-3p	CLIP-seq
MIRT891978	hsa-miR-520b	CLIP-seq
MIRT891979	hsa-miR-520c-3p	CLIP-seq
MIRT891980	hsa-miR-520d-3p	CLIP-seq
MIRT891981	hsa-miR-520e	CLIP-seq
MIRT891982	hsa-miR-520g	CLIP-seq
MIRT891983	hsa-miR-520h	CLIP-seq
MIRT2200473	hsa-miR-532-3p	CLIP-seq
MIRT891985	hsa-miR-762	CLIP-seq
MIRT891986	hsa-miR-764	CLIP-seq
MIRT2200474	hsa-miR-892b	CLIP-seq
MIRT891987	hsa-miR-93	CLIP-seq
MIRT2386067	hsa-miR-1228	CLIP-seq
MIRT891960	hsa-miR-4438	CLIP-seq
MIRT2200468	hsa-miR-4444	CLIP-seq
MIRT2200470	hsa-miR-4532	CLIP-seq
MIRT1964339	hsa-miR-4765	CLIP-seq
MIRT891973	hsa-miR-5095	CLIP-seq
MIRT891929	hsa-miR-122	CLIP-seq
MIRT2386067	hsa-miR-1228	CLIP-seq
MIRT891931	hsa-miR-1273f	CLIP-seq
MIRT891933	hsa-miR-130a	CLIP-seq
MIRT891934	hsa-miR-130b	CLIP-seq
MIRT891936	hsa-miR-143	CLIP-seq
MIRT891941	hsa-miR-301a	CLIP-seq
MIRT891942	hsa-miR-301b	CLIP-seq
MIRT891948	hsa-miR-3135b	CLIP-seq
MIRT891949	hsa-miR-3652	CLIP-seq
MIRT891950	hsa-miR-3666	CLIP-seq
MIRT891957	hsa-miR-4295	CLIP-seq
MIRT891959	hsa-miR-4430	CLIP-seq
MIRT2200468	hsa-miR-4444	CLIP-seq
MIRT2200470	hsa-miR-4532	CLIP-seq
MIRT891964	hsa-miR-4534	CLIP-seq
MIRT891965	hsa-miR-454	CLIP-seq
MIRT891966	hsa-miR-4653-3p	CLIP-seq
MIRT891968	hsa-miR-4708-5p	CLIP-seq
MIRT1964339	hsa-miR-4765	CLIP-seq
MIRT891972	hsa-miR-4770	CLIP-seq
MIRT891927	hsa-miR-106a	CLIP-seq
MIRT891928	hsa-miR-106b	CLIP-seq
MIRT2503261	hsa-miR-1207-5p	CLIP-seq
MIRT891929	hsa-miR-122	CLIP-seq
MIRT2386067	hsa-miR-1228	CLIP-seq
MIRT891930	hsa-miR-125a-3p	CLIP-seq
MIRT891931	hsa-miR-1273f	CLIP-seq
MIRT2503262	hsa-miR-1276	CLIP-seq
MIRT891933	hsa-miR-130a	CLIP-seq
MIRT891934	hsa-miR-130b	CLIP-seq
MIRT891936	hsa-miR-143	CLIP-seq
MIRT891937	hsa-miR-150	CLIP-seq
MIRT891938	hsa-miR-17	CLIP-seq
MIRT2503263	hsa-miR-1909	CLIP-seq
MIRT2503264	hsa-miR-193a-5p	CLIP-seq
MIRT1964334	hsa-miR-1976	CLIP-seq
MIRT891939	hsa-miR-20a	CLIP-seq
MIRT891940	hsa-miR-20b	CLIP-seq
MIRT2503265	hsa-miR-2861	CLIP-seq
MIRT891941	hsa-miR-301a	CLIP-seq
MIRT891942	hsa-miR-301b	CLIP-seq
MIRT891943	hsa-miR-302a	CLIP-seq
MIRT891944	hsa-miR-302b	CLIP-seq
MIRT891945	hsa-miR-302c	CLIP-seq
MIRT891946	hsa-miR-302d	CLIP-seq
MIRT891947	hsa-miR-302e	CLIP-seq
MIRT891948	hsa-miR-3135b	CLIP-seq
MIRT1964335	hsa-miR-325	CLIP-seq
MIRT891949	hsa-miR-3652	CLIP-seq
MIRT891950	hsa-miR-3666	CLIP-seq
MIRT2200465	hsa-miR-3680	CLIP-seq
MIRT891953	hsa-miR-372	CLIP-seq
MIRT891954	hsa-miR-373	CLIP-seq
MIRT2503266	hsa-miR-3925-3p	CLIP-seq
MIRT891955	hsa-miR-3934	CLIP-seq
MIRT2200467	hsa-miR-411	CLIP-seq
MIRT1964336	hsa-miR-4279	CLIP-seq
MIRT891957	hsa-miR-4295	CLIP-seq
MIRT891959	hsa-miR-4430	CLIP-seq
MIRT891960	hsa-miR-4438	CLIP-seq
MIRT2200468	hsa-miR-4444	CLIP-seq
MIRT891961	hsa-miR-4454	CLIP-seq
MIRT2200470	hsa-miR-4532	CLIP-seq
MIRT891964	hsa-miR-4534	CLIP-seq
MIRT891965	hsa-miR-454	CLIP-seq
MIRT891966	hsa-miR-4653-3p	CLIP-seq
MIRT891967	hsa-miR-4707-3p	CLIP-seq
MIRT891968	hsa-miR-4708-5p	CLIP-seq
MIRT1964338	hsa-miR-4722-3p	CLIP-seq
MIRT891970	hsa-miR-4731-5p	CLIP-seq
MIRT2503267	hsa-miR-4733-5p	CLIP-seq
MIRT2503268	hsa-miR-4736	CLIP-seq
MIRT891971	hsa-miR-4757-5p	CLIP-seq
MIRT2503269	hsa-miR-4763-3p	CLIP-seq
MIRT1964339	hsa-miR-4765	CLIP-seq
MIRT891972	hsa-miR-4770	CLIP-seq
MIRT2503270	hsa-miR-4778-3p	CLIP-seq
MIRT891973	hsa-miR-5095	CLIP-seq
MIRT891974	hsa-miR-512-3p	CLIP-seq
MIRT891976	hsa-miR-519d	CLIP-seq
MIRT891977	hsa-miR-520a-3p	CLIP-seq
MIRT891978	hsa-miR-520b	CLIP-seq
MIRT891979	hsa-miR-520c-3p	CLIP-seq
MIRT891980	hsa-miR-520d-3p	CLIP-seq
MIRT891981	hsa-miR-520e	CLIP-seq
MIRT891982	hsa-miR-520g	CLIP-seq
MIRT891983	hsa-miR-520h	CLIP-seq
MIRT2503271	hsa-miR-661	CLIP-seq
MIRT891986	hsa-miR-764	CLIP-seq
MIRT891987	hsa-miR-93	CLIP-seq
MIRT891927	hsa-miR-106a	CLIP-seq
MIRT891928	hsa-miR-106b	CLIP-seq
MIRT891929	hsa-miR-122	CLIP-seq
MIRT2386067	hsa-miR-1228	CLIP-seq
MIRT891930	hsa-miR-125a-3p	CLIP-seq
MIRT891931	hsa-miR-1273f	CLIP-seq
MIRT2503262	hsa-miR-1276	CLIP-seq
MIRT891933	hsa-miR-130a	CLIP-seq
MIRT891934	hsa-miR-130b	CLIP-seq
MIRT891936	hsa-miR-143	CLIP-seq
MIRT891937	hsa-miR-150	CLIP-seq
MIRT891938	hsa-miR-17	CLIP-seq
MIRT1964334	hsa-miR-1976	CLIP-seq
MIRT891939	hsa-miR-20a	CLIP-seq
MIRT891940	hsa-miR-20b	CLIP-seq
MIRT891941	hsa-miR-301a	CLIP-seq
MIRT891942	hsa-miR-301b	CLIP-seq
MIRT891943	hsa-miR-302a	CLIP-seq
MIRT891944	hsa-miR-302b	CLIP-seq
MIRT891945	hsa-miR-302c	CLIP-seq
MIRT891946	hsa-miR-302d	CLIP-seq
MIRT891947	hsa-miR-302e	CLIP-seq
MIRT891948	hsa-miR-3135b	CLIP-seq
MIRT1964335	hsa-miR-325	CLIP-seq
MIRT891949	hsa-miR-3652	CLIP-seq
MIRT891950	hsa-miR-3666	CLIP-seq
MIRT891953	hsa-miR-372	CLIP-seq
MIRT891954	hsa-miR-373	CLIP-seq
MIRT891955	hsa-miR-3934	CLIP-seq
MIRT2200467	hsa-miR-411	CLIP-seq
MIRT1964336	hsa-miR-4279	CLIP-seq
MIRT891957	hsa-miR-4295	CLIP-seq
MIRT891959	hsa-miR-4430	CLIP-seq
MIRT891960	hsa-miR-4438	CLIP-seq
MIRT2200468	hsa-miR-4444	CLIP-seq
MIRT891961	hsa-miR-4454	CLIP-seq
MIRT2200470	hsa-miR-4532	CLIP-seq
MIRT891964	hsa-miR-4534	CLIP-seq
MIRT891965	hsa-miR-454	CLIP-seq
MIRT891966	hsa-miR-4653-3p	CLIP-seq
MIRT891967	hsa-miR-4707-3p	CLIP-seq
MIRT891968	hsa-miR-4708-5p	CLIP-seq
MIRT1964338	hsa-miR-4722-3p	CLIP-seq
MIRT891970	hsa-miR-4731-5p	CLIP-seq
MIRT2503267	hsa-miR-4733-5p	CLIP-seq
MIRT891971	hsa-miR-4757-5p	CLIP-seq
MIRT1964339	hsa-miR-4765	CLIP-seq
MIRT891972	hsa-miR-4770	CLIP-seq
MIRT2503270	hsa-miR-4778-3p	CLIP-seq
MIRT891973	hsa-miR-5095	CLIP-seq
MIRT891974	hsa-miR-512-3p	CLIP-seq
MIRT891976	hsa-miR-519d	CLIP-seq
MIRT891977	hsa-miR-520a-3p	CLIP-seq
MIRT891978	hsa-miR-520b	CLIP-seq
MIRT891979	hsa-miR-520c-3p	CLIP-seq
MIRT891980	hsa-miR-520d-3p	CLIP-seq
MIRT891981	hsa-miR-520e	CLIP-seq
MIRT891982	hsa-miR-520g	CLIP-seq
MIRT891983	hsa-miR-520h	CLIP-seq
MIRT891986	hsa-miR-764	CLIP-seq
MIRT891987	hsa-miR-93	CLIP-seq

Show/Hide all(55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001941	Process	Postsynaptic membrane organization	IMP	8651643
GO:0003009	Process	Skeletal muscle contraction	IBA
GO:0003009	Process	Skeletal muscle contraction	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005230	Function	Extracellular ligand-gated monoatomic ion channel activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	8872460
GO:0005892	Component	Acetylcholine-gated channel complex	IBA
GO:0005892	Component	Acetylcholine-gated channel complex	IEA
GO:0005892	Component	Acetylcholine-gated channel complex	IMP	8872460
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006812	Process	Monoatomic cation transport	IMP	8872460
GO:0006936	Process	Muscle contraction	IMP	8651643
GO:0007165	Process	Signal transduction	IMP	8872460
GO:0007271	Process	Synaptic transmission, cholinergic	IBA
GO:0007271	Process	Synaptic transmission, cholinergic	IMP	8872460
GO:0007274	Process	Neuromuscular synaptic transmission	IMP	8651643
GO:0015267	Function	Channel activity	IMP	8872460
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	IEA
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	ISS
GO:0015464	Function	Acetylcholine receptor activity	IMP	8651643, 8872460
GO:0016020	Component	Membrane	IEA
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	IBA
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	IEA
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	IEA
GO:0022848	Function	Acetylcholine-gated monoatomic cation-selective channel activity	ISS
GO:0031594	Component	Neuromuscular junction	IDA	7531341
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031594	Component	Neuromuscular junction	IMP	7531341
GO:0034220	Process	Monoatomic ion transmembrane transport	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0035095	Process	Behavioral response to nicotine	IMP	16874522
GO:0042166	Function	Acetylcholine binding	IEA
GO:0042166	Function	Acetylcholine binding	ISS
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0042391	Process	Regulation of membrane potential	ISS
GO:0043005	Component	Neuron projection	IBA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	IMP	8872460
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0050877	Process	Nervous system process	IMP	11104662
GO:0051899	Process	Membrane depolarization	IBA
GO:0055001	Process	Muscle cell development	IMP	8651643
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0095500	Process	Acetylcholine receptor signaling pathway	IBA
GO:0099634	Component	Postsynaptic specialization membrane	IEA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IDA	7531341
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IEA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IMP	7531341

MIM	HGNC	e!Ensembl
100710	1961	ENSG00000170175

Protein

UniProt ID

P11230

Protein name

Acetylcholine receptor subunit beta

Protein function

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02931	Neur_chan_LBD	27 → 245	Neurotransmitter-gated ion-channel ligand binding domain	Family
PF02932	Neur_chan_memb	252 → 487	Neurotransmitter-gated ion-channel transmembrane region	Family

Sequence

MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLIL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRL
KRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTS
VGTLVIFLDATYHLPPPDPFP

Sequence length

501

Interactions

View interactions

	KEGG
	Neuroactive ligand-receptor interaction

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Myasthenic Syndrome	Congenital myasthenic syndrome 2A, Congenital myasthenic syndrome 2C, Congenital myasthenic syndrome 4C	rs781689096, rs1447564693, rs1239393228, rs1597749210, rs1908994498, rs137852810, rs137852811, rs199875082, rs201033437	N/A

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	31775875
Arthrogryposis	Associate	33060286
Central Nervous System Vascular Malformations	Associate	33060286
Fetal akinesia syndrome X linked	Associate	18179903
Multiple pterygium syndrome	Associate	18179903
Myasthenia Gravis	Associate	35074870
Myasthenic Syndrome Congenital Fast Channel	Associate	32504635
Myasthenic Syndromes Congenital	Associate	20562457, 27375219, 32504635, 32895905
Tobacco Use Disorder	Associate	20584212

CHRNB1 (cholinergic receptor nicotinic beta 1 subunit)