Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways
Entrez ID	114
Gene name	Adenylate cyclase 8
Gene symbol	ADCY8
Synonyms (NCBI Gene)	AC8ADCY3HBAC1
Chromosome	8
Chromosome location	8q24.22
Summary	Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor t

107

Show/Hide all (107)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003779	Function	Actin binding	ISS
GO:0004016	Function	Adenylate cyclase activity	IBA
GO:0004016	Function	Adenylate cyclase activity	IEA
GO:0004016	Function	Adenylate cyclase activity	TAS	8076676
GO:0005516	Function	Calmodulin binding	ISS
GO:0005524	Function	ATP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	8076676
GO:0005901	Component	Caveola	IEA
GO:0005901	Component	Caveola	ISS
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0005905	Component	Clathrin-coated pit	ISS
GO:0006171	Process	CAMP biosynthetic process	IBA
GO:0006171	Process	CAMP biosynthetic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8076676
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	ISS
GO:0007611	Process	Learning or memory	TAS	8076676
GO:0007613	Process	Memory	IEA
GO:0007613	Process	Memory	ISS
GO:0007616	Process	Long-term memory	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0007626	Process	Locomotory behavior	ISS
GO:0008294	Function	Calcium- and calmodulin-responsive adenylate cyclase activity	IEA
GO:0008294	Function	Calcium- and calmodulin-responsive adenylate cyclase activity	ISS
GO:0008294	Function	Calcium- and calmodulin-responsive adenylate cyclase activity	TAS	8163524
GO:0009190	Process	Cyclic nucleotide biosynthetic process	IEA
GO:0010255	Process	Glucose mediated signaling pathway	IEA
GO:0010255	Process	Glucose mediated signaling pathway	ISS
GO:0014069	Component	Postsynaptic density	IEA
GO:0014069	Component	Postsynaptic density	ISS
GO:0015629	Component	Actin cytoskeleton	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016020	Component	Membrane	TAS	8163524
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0016829	Function	Lyase activity	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IEA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0030665	Component	Clathrin-coated vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031915	Process	Positive regulation of synaptic plasticity	IEA
GO:0031915	Process	Positive regulation of synaptic plasticity	ISS
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0032793	Process	Positive regulation of CREB transcription factor activity	ISS
GO:0032809	Component	Neuronal cell body membrane	IEA
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0034199	Process	Activation of protein kinase A activity	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	ISS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042995	Component	Cell projection	IEA
GO:0044853	Component	Plasma membrane raft	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0046983	Function	Protein dimerization activity	ISS
GO:0048786	Component	Presynaptic active zone	IEA
GO:0048786	Component	Presynaptic active zone	ISS
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0050796	Process	Regulation of insulin secretion	TAS
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051259	Process	Protein complex oligomerization	ISS
GO:0051260	Process	Protein homooligomerization	ISS
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	ISS
GO:0051721	Function	Protein phosphatase 2A binding	ISS
GO:0060076	Component	Excitatory synapse	IEA
GO:0060076	Component	Excitatory synapse	ISS
GO:0071277	Process	Cellular response to calcium ion	ISS
GO:0071315	Process	Cellular response to morphine	IEA
GO:0071315	Process	Cellular response to morphine	ISS
GO:0071333	Process	Cellular response to glucose stimulus	ISS
GO:0071377	Process	Cellular response to glucagon stimulus	IEA
GO:0071377	Process	Cellular response to glucagon stimulus	ISS
GO:0080135	Process	Regulation of cellular response to stress	IEA
GO:0080135	Process	Regulation of cellular response to stress	ISS
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150076	Process	Neuroinflammatory response	IEA
GO:0150076	Process	Neuroinflammatory response	ISS
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	ISS
GO:1900454	Process	Positive regulation of long-term synaptic depression	IEA
GO:1900454	Process	Positive regulation of long-term synaptic depression	ISS
GO:1904322	Process	Cellular response to forskolin	ISS

MIM	HGNC	e!Ensembl
103070	239	ENSG00000155897

P40145

Protein name

Adenylate cyclase type 8 (EC 4.6.1.1) (ATP pyrophosphate-lyase 8) (Adenylate cyclase type VIII) (Adenylyl cyclase 8) (AC8) (Ca(2+)/calmodulin-activated adenylyl cyclase)

Protein function

Catalyzes the formation of cAMP in response to calcium entry leadings to cAMP signaling activation that affect processes suche as synaptic plasticity and insulin secretion. Plays a role in many brain functions, such as learning, memory, drug add

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16214	AC_N	137 → 401	Adenylyl cyclase N-terminal extracellular and transmembrane region	Family
PF00211	Guanylate_cyc	405 → 589	Adenylate and Guanylate cyclase catalytic domain	Domain
PF06327	DUF1053	617 → 712	Domain of Unknown Function (DUF1053)	Family
PF00211	Guanylate_cyc	973 → 1172	Adenylate and Guanylate cyclase catalytic domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in brain cortex (PubMed:1715695). Expressed in islet (PubMed:25403481). {ECO:0000269|PubMed:1715695, ECO:0000269|PubMed:25403481}.

Sequence

MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGS
GSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEV
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP

Sequence length

1251

Interactions

View interactions

	KEGG		Reactome
	Purine metabolism Metabolic pathways Endocrine resistance Rap1 signaling pathway Calcium signaling pathway cGMP-PKG signaling pathway cAMP signaling pathway Chemokine signaling pathway Phospholipase D signaling pathway Hormone signaling Oocyte meiosis Longevity regulating pathway Longevity regulating pathway - multiple species Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Apelin signaling pathway Gap junction Platelet activation Circadian entrainment Thermogenesis Long-term potentiation Retrograde endocannabinoid signaling Glutamatergic synapse Cholinergic synapse GABAergic synapse Taste transduction Inflammatory mediator regulation of TRP channels Insulin secretion GnRH signaling pathway Ovarian steroidogenesis Progesterone-mediated oocyte maturation Estrogen signaling pathway Melanogenesis Thyroid hormone synthesis Oxytocin signaling pathway Regulation of lipolysis in adipocytes Aldosterone synthesis and secretion Relaxin signaling pathway Cortisol synthesis and secretion Parathyroid hormone synthesis, secretion and action Cushing syndrome Growth hormone synthesis, secretion and action Salivary secretion Gastric acid secretion Pancreatic secretion Bile secretion Morphine addiction Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Pathways in cancer Chemical carcinogenesis - receptor activation Dilated cardiomyopathy		Glucagon signaling in metabolic regulation PKA activation PKA activation in glucagon signalling Adenylate cyclase activating pathway Adenylate cyclase inhibitory pathway Glucagon-like Peptide-1 (GLP1) regulates insulin secretion G alpha (s) signalling events G alpha (z) signalling events Vasopressin regulates renal water homeostasis via Aquaporins Hedgehog 'off' state ADORA2B mediated anti-inflammatory cytokines production FCGR3A-mediated IL10 synthesis

ADCY8 (adenylate cyclase 8)