Gene Gene information from NCBI Gene database.
Entrez ID 113791
Gene name Phosphoinositide-3-kinase interacting protein 1
Gene symbol PIK3IP1
Synonyms (NCBI Gene)
HGFLTrIPhHGFL(S)
Chromosome 22
Chromosome location 22q12.2
miRNA miRNA information provided by mirtarbase database.
279
miRTarBase ID miRNA Experiments Reference
MIRT020011 hsa-miR-375 Microarray 20215506
MIRT1234207 hsa-let-7a CLIP-seq
MIRT1234208 hsa-let-7b CLIP-seq
MIRT1234209 hsa-let-7c CLIP-seq
MIRT1234210 hsa-let-7d CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0004175 Function Endopeptidase activity IBA
GO:0005102 Function Signaling receptor binding IBA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005615 Component Extracellular space IBA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619158 24942 ENSG00000100100
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96FE7
Protein name Phosphoinositide-3-kinase-interacting protein 1 (PI3K-interacting protein 1) (Kringle domain-containing protein HGFL)
Protein function Negative regulator of hepatic phosphatidylinositol 3-kinase (PI3K) activity.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00051 Kringle 25 101 Kringle domain Domain
Sequence
MLLAWVQAFLVSNMLLAEAYGSGGCFWDNGHLYREDQTSPAPGLRCLNWLDAQSGLASAP
VSGAGNHSYCRNPDEDPRGPWCYVSGEAGVPEKRPCEDLRC
PETTSQALPAFTTEIQEAS
EGPGADEVQVFAPANALPARSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYSYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDEKTVVVHT
SQTPVDPQEGTTPLMGQAGTPGA
Sequence length 263
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs866587054 RCV004557887
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Brain Edema Associate 24056404
Brain Ischemia Associate 36077416
Breast Neoplasms Associate 36549768
Carcinogenesis Associate 36701842
Carcinoma Hepatocellular Associate 38049860
Hashimoto Disease Stimulate 34867951
Inflammation Associate 30679758
Leukemia Myeloid Acute Associate 36232694
Lymphoma Associate 23676220
Lymphoma Mantle Cell Associate 23676220