CIMAP1A (ciliary microtubule associated protein 1A)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
113746
Gene name Gene Name - the full gene name approved by the HGNC.
Ciliary microtubule associated protein 1A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CIMAP1A
Synonyms (NCBI Gene) Gene synonyms aliases
CT135, ODF3, SHIPPO1, TISP50
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.5
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(12)
miRTarBase ID miRNA Experiments Reference
MIRT2455598 hsa-miR-1205 CLIP-seq
MIRT2455599 hsa-miR-146b-3p CLIP-seq
MIRT2455600 hsa-miR-1909 CLIP-seq
MIRT2455601 hsa-miR-1913 CLIP-seq
MIRT2455602 hsa-miR-3173-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(7)
GO ID Ontology Definition Evidence Reference
GO:0001520 Component Outer dense fiber IBA 21873635
GO:0005515 Function Protein binding IPI 23355646, 32296183
GO:0005737 Component Cytoplasm IEA
GO:0005856 Component Cytoskeleton IBA 21873635
GO:0007275 Process Multicellular organism development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
608356 19905 ENSG00000177947
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96PU9
Protein name Ciliary microtubule associated protein 1A (Outer dense fiber of sperm tails protein 3) (Outer dense fiber protein 3) (Sperm tail protein SHIPPO 1) (Transcript induced in spermiogenesis protein 50)
Protein function Outer dense fibers are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail. May help to maintain the passive elastic structures and elastic recoil of the sperm tail. {ECO:0
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07004 SHIPPO-rpt 25 → 60 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 100 → 131 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 136 → 170 Sperm-tail PG-rich repeat Repeat
PF07004 SHIPPO-rpt 215 → 245 Sperm-tail PG-rich repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Testis-specific. {ECO:0000269|PubMed:11870087, ECO:0000269|Ref.2}.
Sequence 
MTEEVWMGTWRPHRPRGPIMALYSSPGPKYLIPPTTGFMKHTPTKLRAPAYSFRGAPMLL
AENCSPGPRYNVNPKILRTGKDLGPAYSILGRYQTKTMLTPGPGDYFPEKSTKYVFDSAP
SHSISARTKAFRVDSTPGPAAYMLPMVMGPNTVGKASQPSFSIKGRSKLGGFSDDLHKTP
GPAAYRQTDVRVTKFKAPQYTMAARVEPPGDKTLKPGPGAHSPEKVTLTKPCAPVVTFGI
KHSDYMTPLLVDVE
Sequence length 254
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Uterine Fibroids Uterine Fibroids GWAS