Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11344
Gene name Gene Name - the full gene name approved by the HGNC.	Twinfilin actin binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TWF2
Synonyms (NCBI Gene) Gene synonyms aliases	A6RP, A6r, MSTP011, PTK9L
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p21.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene was identified by its interaction with the catalytic domain of protein kinase C-zeta. The encoded protein contains an actin-binding site and an ATP-binding site. It is most closely related to twinfilin (PTK9), a conserved

Show/Hide all(74)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005539	hsa-miR-1-3p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	20571053
MIRT005540	hsa-miR-126-3p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	20571053
MIRT042297	hsa-miR-484	CLASH	23622248
MIRT2139695	hsa-miR-1207-3p	CLIP-seq
MIRT2139696	hsa-miR-1207-5p	CLIP-seq
MIRT2139697	hsa-miR-2276	CLIP-seq
MIRT2139698	hsa-miR-3120-3p	CLIP-seq
MIRT2139699	hsa-miR-4763-3p	CLIP-seq
MIRT2653620	hsa-miR-1206	CLIP-seq
MIRT2653621	hsa-miR-1285	CLIP-seq
MIRT2653622	hsa-miR-1587	CLIP-seq
MIRT2653623	hsa-miR-3187-5p	CLIP-seq
MIRT2653624	hsa-miR-3649	CLIP-seq
MIRT2653625	hsa-miR-378g	CLIP-seq
MIRT2653626	hsa-miR-3926	CLIP-seq
MIRT2653627	hsa-miR-3943	CLIP-seq
MIRT2653628	hsa-miR-4286	CLIP-seq
MIRT2653629	hsa-miR-4313	CLIP-seq
MIRT2653630	hsa-miR-4314	CLIP-seq
MIRT2653631	hsa-miR-4474-3p	CLIP-seq
MIRT2653632	hsa-miR-4474-5p	CLIP-seq
MIRT2653633	hsa-miR-4486	CLIP-seq
MIRT2653634	hsa-miR-4492	CLIP-seq
MIRT2653635	hsa-miR-4498	CLIP-seq
MIRT2653636	hsa-miR-4656	CLIP-seq
MIRT2653637	hsa-miR-4675	CLIP-seq
MIRT2653638	hsa-miR-4707-5p	CLIP-seq
MIRT2653639	hsa-miR-4731-5p	CLIP-seq
MIRT2653640	hsa-miR-4732-3p	CLIP-seq
MIRT2653641	hsa-miR-4741	CLIP-seq
MIRT2653642	hsa-miR-4755-3p	CLIP-seq
MIRT2653643	hsa-miR-548s	CLIP-seq
MIRT2653644	hsa-miR-578	CLIP-seq
MIRT2653645	hsa-miR-581	CLIP-seq
MIRT2653646	hsa-miR-612	CLIP-seq
MIRT2653647	hsa-miR-663b	CLIP-seq
MIRT2653648	hsa-miR-762	CLIP-seq
MIRT2653620	hsa-miR-1206	CLIP-seq
MIRT2139696	hsa-miR-1207-5p	CLIP-seq
MIRT2653621	hsa-miR-1285	CLIP-seq
MIRT2653622	hsa-miR-1587	CLIP-seq
MIRT2653623	hsa-miR-3187-5p	CLIP-seq
MIRT2694513	hsa-miR-3194-5p	CLIP-seq
MIRT2653624	hsa-miR-3649	CLIP-seq
MIRT2653625	hsa-miR-378g	CLIP-seq
MIRT2653626	hsa-miR-3926	CLIP-seq
MIRT2653627	hsa-miR-3943	CLIP-seq
MIRT2653628	hsa-miR-4286	CLIP-seq
MIRT2653629	hsa-miR-4313	CLIP-seq
MIRT2653630	hsa-miR-4314	CLIP-seq
MIRT2653631	hsa-miR-4474-3p	CLIP-seq
MIRT2653632	hsa-miR-4474-5p	CLIP-seq
MIRT2653633	hsa-miR-4486	CLIP-seq
MIRT2653634	hsa-miR-4492	CLIP-seq
MIRT2653635	hsa-miR-4498	CLIP-seq
MIRT2694514	hsa-miR-4514	CLIP-seq
MIRT2694515	hsa-miR-4645-5p	CLIP-seq
MIRT2653636	hsa-miR-4656	CLIP-seq
MIRT2694516	hsa-miR-4673	CLIP-seq
MIRT2653637	hsa-miR-4675	CLIP-seq
MIRT2694517	hsa-miR-4692	CLIP-seq
MIRT2653638	hsa-miR-4707-5p	CLIP-seq
MIRT2653639	hsa-miR-4731-5p	CLIP-seq
MIRT2653640	hsa-miR-4732-3p	CLIP-seq
MIRT2653641	hsa-miR-4741	CLIP-seq
MIRT2653642	hsa-miR-4755-3p	CLIP-seq
MIRT2139699	hsa-miR-4763-3p	CLIP-seq
MIRT2653643	hsa-miR-548s	CLIP-seq
MIRT2653644	hsa-miR-578	CLIP-seq
MIRT2653645	hsa-miR-581	CLIP-seq
MIRT2653646	hsa-miR-612	CLIP-seq
MIRT2653647	hsa-miR-663b	CLIP-seq
MIRT2653648	hsa-miR-762	CLIP-seq
MIRT2694518	hsa-miR-940	CLIP-seq

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003779	Function	Actin binding	IEA
GO:0003785	Function	Actin monomer binding	IBA
GO:0003785	Function	Actin monomer binding	IEA
GO:0003785	Function	Actin monomer binding	ISS	12807912, 18837697
GO:0005080	Function	Protein kinase C binding	IPI	10406962
GO:0005515	Function	Protein binding	IPI	21044950
GO:0005524	Function	ATP binding	IDA	10406962
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IEA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	ISS	12807912
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	10406962
GO:0005856	Component	Cytoskeleton	IEA
GO:0005884	Component	Actin filament	IBA
GO:0010591	Process	Regulation of lamellipodium assembly	IBA
GO:0010592	Process	Positive regulation of lamellipodium assembly	IMP	17910947
GO:0010976	Process	Positive regulation of neuron projection development	IBA
GO:0010976	Process	Positive regulation of neuron projection development	IMP	17910947
GO:0030016	Component	Myofibril	IBA
GO:0030016	Component	Myofibril	ISS	18837697
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS	12807912
GO:0030030	Process	Cell projection organization	IEA
GO:0030042	Process	Actin filament depolymerization	IBA
GO:0030175	Component	Filopodium	IEA
GO:0030175	Component	Filopodium	ISS	12807912
GO:0030426	Component	Growth cone	IDA	17910947
GO:0030837	Process	Negative regulation of actin filament polymerization	IEA
GO:0030837	Process	Negative regulation of actin filament polymerization	ISS	12807912
GO:0032420	Component	Stereocilium	IEA
GO:0032420	Component	Stereocilium	ISS	19955359
GO:0032532	Process	Regulation of microvillus length	IC	19955359
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	17910947
GO:0042995	Component	Cell projection	IEA
GO:0043168	Function	Anion binding	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045773	Process	Positive regulation of axon extension	IMP	17910947
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS	12807912
GO:0051015	Function	Actin filament binding	IBA
GO:0051016	Process	Barbed-end actin filament capping	IBA
GO:0051016	Process	Barbed-end actin filament capping	ISS	18837697
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0071300	Process	Cellular response to retinoic acid	IMP	17910947
GO:0071363	Process	Cellular response to growth factor stimulus	IMP	17910947

MIM	HGNC	e!Ensembl
607433	9621	ENSG00000247596

Protein

UniProt ID

Q6IBS0

Protein name

Twinfilin-2 (A6-related protein) (hA6RP) (Protein tyrosine kinase 9-like) (Twinfilin-1-like protein)

Protein function

Actin-binding protein involved in motile and morphological processes. Inhibits actin polymerization, likely by sequestering G-actin. By capping the barbed ends of filaments, it also regulates motility. Seems to play an important role in clathrin

PDB

2VAC , 2W0I

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00241	Cofilin_ADF	9 → 137	Cofilin/tropomyosin-type actin-binding protein	Domain
PF00241	Cofilin_ADF	186 → 311	Cofilin/tropomyosin-type actin-binding protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed (at protein level). {ECO:0000269|PubMed:10406962}.

Sequence

MAHQTGIHATEELKEFFAKARAGSVRLIKVVIEDEQLVLGASQEPVGRWDQDYDRAVLPL
LDAQQPCYLLYRLDSQNAQGFEWLFLAWSPDNSPVRLKMLYAATRATVKKEFGGGHIKDE
LFGTVKDDLSFAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAF
PLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVPRDAARYHFFL
YKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSRLLDSVEQDFHLEIAKKIEIGDG
AELTAEFLYDEVHPKQHAFKQAFAKPKGPGGKRGHKRLIRGPGENGDDS

Sequence length

349

Interactions

View interactions

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar disorder	N/A	N/A	GWAS
Colorectal Cancer	Distal colorectal cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Spinal Dysraphism	Associate	37055180
Tuberculosis Meningeal	Associate	25616954
Tuberculosis Pulmonary	Associate	25616954

TWF2 (twinfilin actin binding protein 2)