Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11342
Gene name Gene Name - the full gene name approved by the HGNC.
Ring finger protein 13
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RNF13
Synonyms (NCBI Gene) Gene synonyms aliases
DEE73, EIEE73, RZF
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q25.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. The specific function of this gene has not yet been determined. Alternatively spliced transcript variants that encode the same prot
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1559980771 T>C Pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs1559980785 T>C Pathogenic Non coding transcript variant, missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027479 hsa-miR-98-5p Microarray 19088304
MIRT449458 hsa-miR-4680-3p PAR-CLIP 22100165
MIRT449457 hsa-miR-219b-3p PAR-CLIP 22100165
MIRT449456 hsa-miR-219a-2-3p PAR-CLIP 22100165
MIRT449455 hsa-miR-3160-3p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004842 Function Ubiquitin-protein transferase activity IEA
GO:0004842 Function Ubiquitin-protein transferase activity ISS
GO:0005515 Function Protein binding IPI 19690564, 25260751
GO:0005634 Component Nucleus IEA
GO:0005637 Component Nuclear inner membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609247 10057 ENSG00000082996
Protein
UniProt ID O43567
Protein name E3 ubiquitin-protein ligase RNF13 (EC 2.3.2.27) (RING finger protein 13)
Protein function E3 ubiquitin-protein ligase that regulates cell proliferation (PubMed:18794910, PubMed:23378536, PubMed:30595371). Involved in apoptosis regulation (PubMed:23378536, PubMed:30595371). Mediates ER stress-induced activation of JNK signaling pathwa
PDB 5ZBU , 5ZC4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02225 PA 64 158 PA domain Family
PF13639 zf-RING_2 238 282 Ring finger domain Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed (at protein level). In normal pancreas, expressed in islets, but not in ducts, nor in acini (at protein level). {ECO:0000269|PubMed:18794910}.
Sequence
MLLSIGMLMLSATQVYTILTVQLFAFLNLLPVEADILAYNFENASQTFDDLPARFGYRLP
AEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAI
VHNVDSDDLISMGSNDIEVLKKIDIPSVFIGESSANSL
KDEFTYEKGGHLILVPEFSLPL
EYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQLKKLPVHKFKKGDEYDVC
AICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCK
QKVVPSQGDSDSDTDSSQ
EENEVTEHTPLLRPLASVSAQSFGALSESRSHQNMTESSDYEEDDNEDTDSSDAENEINE
HDVVVQLQPNGERDYNIANTV
Sequence length 381
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Developmental And Epileptic Encephalopathy Developmental and epileptic encephalopathy, 73 rs1559980771, rs1559980785 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Blindness Associate 30595371
Brain Diseases Associate 30595371
Developmental Disabilities Associate 30595371
Epileptic Encephalopathy Early Infantile 3 Associate 34831286
Leukemia Myeloid Acute Associate 33083473
Microcephaly Associate 30595371
Neurodegenerative Diseases Associate 30595371
Uveal melanoma Associate 33387485