Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11340
Gene name Gene Name - the full gene name approved by the HGNC.	Exosome component 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EXOSC8
Synonyms (NCBI Gene) Gene synonyms aliases	CIP3, EAP2, OIP2, PCH1C, RRP43, Rrp43p, bA421P11.3, p9
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a 3`-5` exoribonuclease that specifically interacts with mRNAs containing AU-rich elements. The encoded protein is part of the exosome complex that is important for the degradation of numerous RNA species. A pseudogene of this gene is fo

Show/Hide all(18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030408	hsa-miR-24-3p	Microarray	19748357
MIRT973355	hsa-miR-192	CLIP-seq
MIRT973356	hsa-miR-215	CLIP-seq
MIRT973357	hsa-miR-299-5p	CLIP-seq
MIRT973358	hsa-miR-3688-3p	CLIP-seq
MIRT973359	hsa-miR-522	CLIP-seq
MIRT973360	hsa-miR-548ac	CLIP-seq
MIRT973361	hsa-miR-548ae	CLIP-seq
MIRT973362	hsa-miR-548aj	CLIP-seq
MIRT973363	hsa-miR-548am	CLIP-seq
MIRT973364	hsa-miR-548d-3p	CLIP-seq
MIRT973365	hsa-miR-548x	CLIP-seq
MIRT973366	hsa-miR-548z	CLIP-seq
MIRT2449007	hsa-miR-2052	CLIP-seq
MIRT2449008	hsa-miR-4666-3p	CLIP-seq
MIRT2449009	hsa-miR-4762-5p	CLIP-seq
MIRT2449010	hsa-miR-520d-5p	CLIP-seq
MIRT2449011	hsa-miR-524-5p	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000176	Component	Nuclear exosome (RNase complex)	IBA
GO:0000176	Component	Nuclear exosome (RNase complex)	NAS	20531386
GO:0000177	Component	Cytoplasmic exosome (RNase complex)	IBA
GO:0000177	Component	Cytoplasmic exosome (RNase complex)	NAS	20531386
GO:0000178	Component	Exosome (RNase complex)	IDA	20531389
GO:0000178	Component	Exosome (RNase complex)	IEA
GO:0000178	Component	Exosome (RNase complex)	NAS	20531386
GO:0000467	Process	Exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)	IBA
GO:0001650	Component	Fibrillar center	IDA
GO:0003723	Function	RNA binding	IEA
GO:0004532	Function	RNA exonuclease activity	IDA	17174896
GO:0005515	Function	Protein binding	IPI	12419256, 15231747, 20531389, 21255825, 24981860, 25043052, 25416956, 25910212, 26496610, 26871637, 28514442, 31515488, 32296183, 33961781, 39251607
GO:0005634	Component	Nucleus	IDA	17545563, 20531386
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IDA
GO:0005730	Component	Nucleolus	IDA	20531386
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	17545563
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	20531386
GO:0005829	Component	Cytosol	TAS
GO:0006364	Process	RRNA processing	IEA
GO:0006396	Process	RNA processing	IDA	17174896, 20531386
GO:0006396	Process	RNA processing	IEA
GO:0006401	Process	RNA catabolic process	IDA	17174896, 20531386
GO:0006401	Process	RNA catabolic process	IEA
GO:0016075	Process	RRNA catabolic process	IBA
GO:0034473	Process	U1 snRNA 3'-end processing	IBA
GO:0034475	Process	U4 snRNA 3'-end processing	IBA
GO:0034476	Process	U5 snRNA 3'-end processing	IBA
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IBA
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	16912217
GO:0042802	Function	Identical protein binding	IPI	15231747, 25416956, 32296183
GO:0071028	Process	Nuclear mRNA surveillance	IBA
GO:0071035	Process	Nuclear polyadenylation-dependent rRNA catabolic process	IBA
GO:0071038	Process	TRAMP-dependent tRNA surveillance pathway	IBA
GO:0101019	Component	Nucleolar exosome (RNase complex)	NAS	20531386
GO:1905354	Component	Exoribonuclease complex	IEA

MIM	HGNC	e!Ensembl
606019	17035	ENSG00000120699

Protein

UniProt ID

Q96B26

Protein name

Exosome complex component RRP43 (Exosome component 8) (Opa-interacting protein 2) (OIP-2) (Ribosomal RNA-processing protein 43) (p9)

Protein function

Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturat

PDB

2NN6 , 6D6Q , 6D6R , 6H25 , 9G8M , 9G8N , 9G8O , 9G8P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01138	RNase_PH	31 → 166		Domain
PF03725	RNase_PH_C	191 → 258		Domain

Sequence

MAAGFKTVEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVIC
GVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQ
KEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETALAEVN
LKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVMDEEGKLCCLHKPGG
SGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK

Sequence length

276

Interactions

View interactions

	KEGG		Reactome
	RNA degradation		ATF4 activates genes in response to endoplasmic reticulum stress mRNA decay by 3' to 5' exoribonuclease Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA Tristetraprolin (TTP, ZFP36) binds and destabilizes mRNA KSRP (KHSRP) binds and destabilizes mRNA Major pathway of rRNA processing in the nucleolus and cytosol

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Pontoneocerebellar hypoplasia	pontocerebellar hypoplasia, type 1c	rs606231285	N/A

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
13q deletion syndrome	Stimulate	34573300
Contracture	Associate	38017281
Esotropia	Associate	38017281
Facies	Associate	38017281
Neoplasms	Associate	32433464
Nervous System Diseases	Associate	34573300
Nystagmus Pathologic	Associate	38017281
Pontocerebellar Hypoplasia	Associate	38017281
Prostatic Neoplasms	Associate	28403887
Signs and Symptoms Respiratory	Associate	38017281

EXOSC8 (exosome component 8)