Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11333
Gene name Gene Name - the full gene name approved by the HGNC.
PDGFA associated protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PDAP1
Synonyms (NCBI Gene) Gene synonyms aliases
HASPP28, PAP, PAP1
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a phosphoprotein that may upregulate the PDGFA-stimulated growth of fibroblasts and also downregulate the mitogenicity of PDGFB. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. [provided
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT020607 hsa-miR-155-5p Proteomics 18668040
MIRT022255 hsa-miR-124-3p Microarray 18668037
MIRT049697 hsa-miR-92a-3p CLASH 23622248
MIRT049697 hsa-miR-92a-3p CLASH 23622248
MIRT045275 hsa-miR-186-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding HDA 22681889
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region TAS
GO:0005829 Component Cytosol IBA 21873635
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607075 14634 ENSG00000106244
Protein
UniProt ID Q13442
Protein name 28 kDa heat- and acid-stable phosphoprotein (PDGF-associated protein) (PAP) (PDGFA-associated protein 1) (PAP1)
Protein function Enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF10252 PP28 85 163 Casein kinase substrate phosphoprotein PP28 Domain
Sequence
MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDS
DESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKA
KERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKA
KDDATLSGKRMQSLSLN
K
Sequence length 181
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Retinitis pigmentosa Retinitis Pigmentosa rs267606794, rs200691042, rs397704718, rs202193201, rs267606793, rs2147483647, rs779886453, rs267606691, rs794728002, rs878853253, rs137853189, rs137853190, rs137853112, rs137853113, rs137853114
View all (1830 more)
Associations from Text Mining
Disease Name Relationship Type References
Carcinoma Pancreatic Ductal Associate 36047966
Cystitis Associate 2563254
Precursor Cell Lymphoblastic Leukemia Lymphoma Associate 29656114
Prostatic Neoplasms Associate 24242705, 25591398
Pyelonephritis Associate 2563254
Stomach Neoplasms Associate 23161554