Gene Gene information from NCBI Gene database.
Entrez ID 113130
Gene name Cell division cycle associated 5
Gene symbol CDCA5
Synonyms (NCBI Gene)
SORORIN
Chromosome 11
Chromosome location 11q13.1
miRNA miRNA information provided by mirtarbase database.
221
miRTarBase ID miRNA Experiments Reference
MIRT016488 hsa-miR-193b-3p Microarray 20304954
MIRT050732 hsa-miR-18a-5p CLASH 23622248
MIRT042416 hsa-miR-18b-5p CLASH 23622248
MIRT878939 hsa-miR-1197 CLIP-seq
MIRT878940 hsa-miR-1224-5p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region TAS
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISS
GO:0003682 Function Chromatin binding TAS 15837422
GO:0005515 Function Protein binding IPI 21111234, 22885700, 23242214, 26496610, 32296183, 33961781, 35271311
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609374 14626 ENSG00000146670
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96FF9
Protein name Sororin (Cell division cycle-associated protein 5) (p35)
Protein function Regulator of sister chromatid cohesion in mitosis stabilizing cohesin complex association with chromatin. May antagonize the action of WAPL which stimulates cohesin dissociation from chromatin. Cohesion ensures that chromosome partitioning is ac
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09666 Sororin 89 215 Sororin protein Family
Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVL
KRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNP
EAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGV
SPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQ
KRKKKKMPEILKTELDEWAAAMNAE
FEAAEQFDLLVE
Sequence length 252
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cell cycle
MicroRNAs in cancer
  Separation of Sister Chromatids
Establishment of Sister Chromatid Cohesion
Resolution of Sister Chromatid Cohesion
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Uncertain significance rs200209838 RCV005930987
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32149105, 35354488, 35373420
Atrial Fibrillation Associate 35003319
Breast Neoplasms Stimulate 31280346
Breast Neoplasms Associate 31758680, 35506437, 36004470
Carcinogenesis Associate 36233194
Carcinoma Hepatocellular Associate 31811111, 32694239, 33830865, 34737790, 39874008
Carcinoma Non Small Cell Lung Associate 35373420
Carcinoma Ovarian Epithelial Associate 34143800
Colorectal Neoplasms Associate 33190424
Fibrosarcoma Associate 35993042