Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
113130
Gene name Gene Name - the full gene name approved by the HGNC.
Cell division cycle associated 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDCA5
Synonyms (NCBI Gene) Gene synonyms aliases
SORORIN
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q13.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016488 hsa-miR-193b-3p Microarray 20304954
MIRT050732 hsa-miR-18a-5p CLASH 23622248
MIRT042416 hsa-miR-18b-5p CLASH 23622248
MIRT878939 hsa-miR-1197 CLIP-seq
MIRT878940 hsa-miR-1224-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000775 Component Chromosome, centromeric region TAS
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISS
GO:0003682 Function Chromatin binding TAS 15837422
GO:0005515 Function Protein binding IPI 21111234, 22885700, 23242214, 26496610, 32296183, 33961781, 35271311
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609374 14626 ENSG00000146670
Protein
UniProt ID Q96FF9
Protein name Sororin (Cell division cycle-associated protein 5) (p35)
Protein function Regulator of sister chromatid cohesion in mitosis stabilizing cohesin complex association with chromatin. May antagonize the action of WAPL which stimulates cohesin dissociation from chromatin. Cohesion ensures that chromosome partitioning is ac
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09666 Sororin 89 215 Sororin protein Family
Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVL
KRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNP
EAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGV
SPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQ
KRKKKKMPEILKTELDEWAAAMNAE
FEAAEQFDLLVE
Sequence length 252
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell cycle
MicroRNAs in cancer
  Separation of Sister Chromatids
Establishment of Sister Chromatid Cohesion
Resolution of Sister Chromatid Cohesion
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32149105, 35354488, 35373420
Atrial Fibrillation Associate 35003319
Breast Neoplasms Stimulate 31280346
Breast Neoplasms Associate 31758680, 35506437, 36004470
Carcinogenesis Associate 36233194
Carcinoma Hepatocellular Associate 31811111, 32694239, 33830865, 34737790, 39874008
Carcinoma Non Small Cell Lung Associate 35373420
Carcinoma Ovarian Epithelial Associate 34143800
Colorectal Neoplasms Associate 33190424
Fibrosarcoma Associate 35993042