Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein
Entrez ID	112869
Gene name	SAGA complex associated factor 29
Gene symbol	SGF29
Synonyms (NCBI Gene)	CCDC101STAF36TDRD29
Chromosome	16
Chromosome location	16p11.2
Summary	CCDC101 is a subunit of 2 histone acetyltransferase complexes: the ADA2A (TADA2A; MIM 602276)-containing (ATAC) complex and the SPT3 (SUPT3H; MIM 602947)-TAF9 (MIM 600822)-GCN5 (KAT2A; MIM 602301)/PCAF (KAT2B; MIM 602303) acetylase (STAGA) complex. Both o

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18838386
GO:0000124	Component	SAGA complex	IBA
GO:0000124	Component	SAGA complex	IEA
GO:0000124	Component	SAGA complex	NAS	19114550
GO:0005515	Function	Protein binding	IPI	16189514, 21685874, 24981860, 25416956, 25609649, 26496610, 28514442, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006282	Process	Regulation of DNA repair	IEA
GO:0006282	Process	Regulation of DNA repair	NAS	11564863
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IMP	19936620
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	22055187
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0019219	Process	Regulation of nucleobase-containing compound metabolic process	IEA
GO:0034976	Process	Response to endoplasmic reticulum stress	IMP	23894581
GO:0043484	Process	Regulation of RNA splicing	NAS	11564863
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IMP	23894581
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	18206972
GO:0045995	Process	Regulation of embryonic development	IEA
GO:0045995	Process	Regulation of embryonic development	ISO
GO:0045995	Process	Regulation of embryonic development	ISS
GO:0051302	Process	Regulation of cell division	IDA	20562830
GO:0051302	Process	Regulation of cell division	IEA
GO:0051302	Process	Regulation of cell division	ISS
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	19103755
GO:0051726	Process	Regulation of cell cycle	ISS
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0070461	Component	SAGA-type complex	IDA	18838386, 20850016
GO:0071169	Process	Establishment of protein localization to chromatin	TAS	20850016
GO:0072686	Component	Mitotic spindle	NAS	20562830
GO:0140002	Function	Histone H3K4me3 reader activity	IDA	26421618
GO:0140003	Function	Histone H3K36me3 reader activity	IDA	20850016
GO:0140034	Function	Methylation-dependent protein binding	IEA
GO:0140672	Component	ATAC complex	IDA	18838386, 19936620
GO:0140672	Component	ATAC complex	IEA
GO:0140672	Component	ATAC complex	ISO

MIM	HGNC	e!Ensembl
613374	25156	ENSG00000176476

Q96ES7

Protein name

SAGA-associated factor 29 (Coiled-coil domain-containing protein 101) (SAGA complex-associated factor 29)

Protein function

Chromatin reader component of some histone acetyltransferase (HAT) SAGA-type complexes like the TFTC-HAT, ATAC or STAGA complexes (PubMed:19103755, PubMed:20850016, PubMed:21685874, PubMed:26421618, PubMed:26578293). SGF29 specifically recognize

PDB

3LX7 , 3ME9 , 3MEA , 3MET , 3MEU , 3MEV , 3MEW , 5C0M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07039	DUF1325	158 → 288	SGF29 tudor-like domain	Domain

Sequence

MALVSADSRIAELLTELHQLIKQTQEERSRSEHNLVNIQKTHERMQTENKISPYYRTKLR
GLYTTAKADAEAECNILRKALDKIAEIKSLLEERRIAAKIAGLYNDSEPPRKTMRRGVLM
TLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEV
VSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQ
TTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVACKEPKKK

Sequence length

293

Interactions

View interactions

SGF29 (SAGA complex associated factor 29)