Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11284
Gene name Gene Name - the full gene name approved by the HGNC.
Polynucleotide kinase 3'-phosphatase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PNKP
Synonyms (NCBI Gene) Gene synonyms aliases
AOA4, CMT2B2, EIEE10, MCSZ, PNK
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.33
Summary Summary of gene provided in NCBI Entrez Gene.
This locus represents a gene involved in DNA repair. In response to ionizing radiation or oxidative damage, the protein encoded by this locus catalyzes 5` phosphorylation and 3` dephosphorylation of nucleic acids. Mutations at this locus have been associa
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs3739173 G>A Uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs3739200 ->G Conflicting-interpretations-of-pathogenicity Intron variant
rs34472250 C>G,T Likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
rs75203375 C>G Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, synonymous variant
rs115259839 G>A,C Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029605 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003684 Function Damaged DNA binding NAS 10446193
GO:0003690 Function Double-stranded DNA binding TAS 10446193
GO:0003824 Function Catalytic activity IEA
GO:0004519 Function Endonuclease activity NAS 10446192
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605610 9154 ENSG00000039650
Protein
UniProt ID Q96T60
Protein name Bifunctional polynucleotide phosphatase/kinase (DNA 5'-kinase/3'-phosphatase) (Polynucleotide kinase-3'-phosphatase) [Includes: Polynucleotide 3'-phosphatase (EC 3.1.3.32) (2'(3')-polynucleotidase); Polynucleotide 5'-hydroxyl-kinase (EC 2.7.1.78)]
Protein function Plays a key role in the repair of DNA damage, functioning as part of both the non-homologous end-joining (NHEJ) and base excision repair (BER) pathways (PubMed:10446192, PubMed:10446193, PubMed:15385968, PubMed:20852255, PubMed:28453785). Throug
PDB 2BRF , 2W3O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF17913 FHA_2 10 107 FHA domain Domain
PF08645 PNK3P 166 328 Polynucleotide kinase 3 phosphatase Family
PF13671 AAA_33 367 407 Domain
PF13671 AAA_33 399 489 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in many tissues with highest expression in spleen and testis, and lowest expression in small intestine (PubMed:10446192). Expressed in higher amount in pancreas, heart and kidney and at lower levels in brain, lung and liver (
Sequence
MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETR
TVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWE
ETRTPESQPDTPP
GTPLVSQDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTR
SGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVV
EKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPG
RKKKDFSCADRLFALNLGLPFATPEEFF
LKWPAAGFELPAFDPRTVSRSGPLCLPESRAL
LSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVA
IDNTNPDAASRARYVQCARAAGVPCRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMY
GYRKQFEAP
TLAEGFSAILEIPFRLWVEPRLGRLYCQFSEG
Sequence length 521
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Base excision repair   APEX1-Independent Resolution of AP Sites via the Single Nucleotide Replacement Pathway
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Ataxia-Oculomotor Apraxia Ataxia - oculomotor apraxia type 4 rs756746191, rs786203983, rs886037744, rs1555810613, rs786205207, rs587784365 N/A
Charcot-Marie-Tooth Disease charcot-marie-tooth disease type 2b2 rs796052862, rs1247055716, rs786205207 N/A
Developmental And Epileptic Encephalopathy Developmental and epileptic encephalopathy, 12 rs786205207, rs539286945, rs796052862, rs1131691883, rs796052860, rs587784366, rs1366190965, rs267606956, rs2074784617, rs786203983, rs772727116, rs1247055716, rs745505490, rs796052850, rs587784365
View all (9 more)
N/A
MICROCEPHALY, SEIZURES, AND DEVELOPMENTAL DELAY microcephaly, seizures, and developmental delay rs587784366, rs1600416052, rs267606956, rs1247055716, rs587784365, rs786203983, rs752902474, rs786205207, rs267606957 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Epileptic encephalopathy epileptic encephalopathy N/A N/A ClinVar
Heart Failure Heart failure N/A N/A GWAS
Pyridoxine-Dependent Epilepsy pyridoxine-dependent epilepsy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Associate 18414202
Amyotrophic Lateral Sclerosis Associate 32005289
Apraxia oculomotor Cogan type Associate 35326432
Ataxia Associate 25728773, 27165045, 30039206
Autosomal Recessive Primary Microcephaly Associate 34697416
Brain Neoplasms Associate 35354845
Cerebellar Diseases Associate 32980744, 35326432
Charcot Marie Tooth Disease Associate 30039206, 32504494, 34697416
Charcot Marie Tooth disease Type 2B2 Associate 30039206, 32504494
Charcot Marie Tooth disease X linked recessive 2 Associate 31167812