CYP4F8 (cytochrome P450 family 4 subfamily F member 8)

Gene

• Entrez ID: 11283
• Gene name: Cytochrome P450 family 4 subfamily F member 8
• Gene symbol: CYP4F8
• Synonyms (NCBI Gene): CPF8, CYPIVF8
• Chromosome: 19
• Chromosome location: 19p13.12
• Summary: This gene, CYP4F8, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This prot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030046	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004497	Function	Monooxygenase activity	IEA
GO:0004497	Function	Monooxygenase activity	TAS
GO:0005506	Function	Iron ion binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006690	Process	Icosanoid metabolic process	TAS
GO:0006693	Process	Prostaglandin metabolic process	TAS	10405341
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016705	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA
GO:0016712	Function	Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen	IEA
GO:0018685	Function	Alkane 1-monooxygenase activity	TAS	10405341
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0020037	Function	Heme binding	IEA
GO:0042361	Process	Menaquinone catabolic process	IBA
GO:0042376	Process	Phylloquinone catabolic process	IBA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 611545
• HGNC: 2648
• e!Ensembl: ENSG00000186526

Protein

• UniProt ID: P98187
• Protein name: Cytochrome P450 4F8 (EC 1.14.14.1) (CYPIVF8)
• Protein function: A cytochrome P450 monooxygenase involved in the metabolism of endogenous polyunsaturated fatty acids (PUFAs) and their oxygenated derivatives (oxylipins). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and red
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00067	p450	52 → 515	Cytochrome P450	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the epithelium of seminal vesicles, in renal cortex, in adult and fetal liver, in epidermis, in corneal epithelium, in sweat glands, hair follicles, epithelial linings of the ampulla of vas deferens and of the stomach and
• Sequence:

  MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWF
  LGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDK
  DIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQR
  LAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFF
  RYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFID
  VLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE
  LLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVC
  NINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKV
  VLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG

• Sequence length: 520

Pathways

KEGG:

Arachidonic acid metabolism
Metabolic pathways

Reactome:

Fatty acids
Eicosanoids
Synthesis of Leukotrienes (LT) and Eoxins (EX)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBROVASCULAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACEREBRAL HEMORRHAGE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL HEMORRHAGE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Associate	33991433	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	38172792	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	21281786	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	36514150, 38172792	★☆☆☆☆ Found in Text Mining only