Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	11282
Gene name Gene Name - the full gene name approved by the HGNC.	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MGAT4B
Synonyms (NCBI Gene) Gene synonyms aliases	GNT-IV, GNT-IVB
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q35.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme A, catalyzes the transfer of N-acetylglucosamine (Gl

Show/Hide all(24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046626	hsa-miR-222-3p	CLASH	23622248
MIRT042146	hsa-miR-484	CLASH	23622248
MIRT1147317	hsa-miR-1304	CLIP-seq
MIRT1147318	hsa-miR-1827	CLIP-seq
MIRT1147319	hsa-miR-603	CLIP-seq
MIRT1147320	hsa-miR-224	CLIP-seq
MIRT1147321	hsa-miR-556-3p	CLIP-seq
MIRT2041886	hsa-miR-128	CLIP-seq
MIRT2041887	hsa-miR-299-3p	CLIP-seq
MIRT2041888	hsa-miR-3151	CLIP-seq
MIRT2041889	hsa-miR-4269	CLIP-seq
MIRT2041890	hsa-miR-4302	CLIP-seq
MIRT2041891	hsa-miR-4447	CLIP-seq
MIRT2041892	hsa-miR-4472	CLIP-seq
MIRT2041893	hsa-miR-4488	CLIP-seq
MIRT2041894	hsa-miR-4491	CLIP-seq
MIRT2041895	hsa-miR-4497	CLIP-seq
MIRT2041896	hsa-miR-4514	CLIP-seq
MIRT2041897	hsa-miR-4657	CLIP-seq
MIRT2041898	hsa-miR-4692	CLIP-seq
MIRT2041899	hsa-miR-4697-5p	CLIP-seq
MIRT2041900	hsa-miR-4742-5p	CLIP-seq
MIRT2041901	hsa-miR-486-3p	CLIP-seq
MIRT2041902	hsa-miR-491-5p	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005515	Function	Protein binding	IPI	32296183, 32814053, 34981577
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005795	Component	Golgi stack	IBA
GO:0006486	Process	Protein glycosylation	IDA	17006639
GO:0006486	Process	Protein glycosylation	IEA
GO:0006487	Process	Protein N-linked glycosylation	IBA
GO:0006487	Process	Protein N-linked glycosylation	IEA
GO:0006491	Process	N-glycan processing	TAS	10372966
GO:0008375	Function	Acetylglucosaminyltransferase activity	IBA
GO:0008375	Function	Acetylglucosaminyltransferase activity	IEA
GO:0008454	Function	Alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	IDA	10372966, 17006639
GO:0008454	Function	Alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	IEA
GO:0008454	Function	Alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	TAS	10372966
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0019082	Process	Viral protein processing	TAS
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
604561	7048	ENSG00000161013

Protein

UniProt ID

Q9UQ53

Protein name

Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B (EC 2.4.1.145) (N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb) (GlcNAc-T IVb) (GnT-IVb) (N-acetylglucosaminyltransferase IVb) (UDP-N-acetylglucosamine:

Protein function

Glycosyltransferase that catalyzes the transfer of GlcNAc from UDP-GlcNAc to the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans through a beta1-4 linkage and participates in the production of tri- and tetra-antennary N-li

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04666	Glyco_transf_54	98 → 387		Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Strongly overexpressed in pancreatic cancer. {ECO:0000269|PubMed:10372966}.

Sequence

MRLRNGTFLTLLLFCLCAFLSLSWYAALSGQKGDVVDVYQREFLALRDRLHAAEQESLKR
SKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLP
HLLAKESSLQPAVRVGQGRTGVSVVMGIPSVRREVHSYLTDTLHSLISELSPQEKEDSVI
VVLIAETDSQYTSAVTENIKALFPTEIHSGLLEVISPSPHFYPDFSRLRESFGDPKERVR
WRTKQNLDYCFLMMYAQSKGIYYVQLEDDIVAKPNYLSTMKNFALQQPSEDWMILEFSQL
GFIGKMFKSLDLSLIVEFILMFYRDKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIR
FKPSLFQHVGTHSSLAGKIQKLKDKDFGKQALRKEHVNPPAEVSTSLKTYQHFTLEKAYL
REDFFWAFTPAAGDFIRFRFFQPLRLERFFFRSGNIEHPEDKLFNTSVEVLPFDNPQSDK
EALQEGRTATLRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEALRLSIQTDSPVWVILS
EIFLKKAD

Sequence length

548

Interactions

View interactions

	KEGG		Reactome
	N-Glycan biosynthesis Various types of N-glycan biosynthesis Metabolic pathways		N-Glycan antennae elongation

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Mental Depression	Major depressive disorder	N/A	N/A	GWAS

MGAT4B (alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B)