Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1128
Gene name Gene Name - the full gene name approved by the HGNC.	Cholinergic receptor muscarinic 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CHRM1
Synonyms (NCBI Gene) Gene synonyms aliases	HM1, M1, M1R
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, pho

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007151	hsa-miR-107	Luciferase reporter assay	23423139
MIRT891610	hsa-miR-1197	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT891612	hsa-miR-3064-5p	CLIP-seq
MIRT891613	hsa-miR-3652	CLIP-seq
MIRT891614	hsa-miR-370	CLIP-seq
MIRT891615	hsa-miR-3925-5p	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891617	hsa-miR-4430	CLIP-seq
MIRT891618	hsa-miR-4436a	CLIP-seq
MIRT891619	hsa-miR-4505	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT891621	hsa-miR-4640-5p	CLIP-seq
MIRT891622	hsa-miR-4650-5p	CLIP-seq
MIRT891623	hsa-miR-4726-5p	CLIP-seq
MIRT891624	hsa-miR-4755-3p	CLIP-seq
MIRT891625	hsa-miR-589	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT1964263	hsa-miR-149	CLIP-seq
MIRT1964264	hsa-miR-1915	CLIP-seq
MIRT891613	hsa-miR-3652	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891617	hsa-miR-4430	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT1964265	hsa-miR-628-5p	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT2386043	hsa-miR-1207-5p	CLIP-seq
MIRT891611	hsa-miR-127-3p	CLIP-seq
MIRT2386044	hsa-miR-1909	CLIP-seq
MIRT2386045	hsa-miR-3188	CLIP-seq
MIRT2386046	hsa-miR-326	CLIP-seq
MIRT2386047	hsa-miR-330-5p	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT891620	hsa-miR-4532	CLIP-seq
MIRT2386048	hsa-miR-4667-5p	CLIP-seq
MIRT2386049	hsa-miR-4700-5p	CLIP-seq
MIRT2386050	hsa-miR-4763-3p	CLIP-seq
MIRT2386051	hsa-miR-486-3p	CLIP-seq
MIRT2386052	hsa-miR-637	CLIP-seq
MIRT2386053	hsa-miR-942	CLIP-seq
MIRT2503220	hsa-miR-1289	CLIP-seq
MIRT891616	hsa-miR-3940-3p	CLIP-seq
MIRT2503221	hsa-miR-4470	CLIP-seq

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004435	Function	Phosphatidylinositol phospholipase C activity	TAS	9614217
GO:0004993	Function	G protein-coupled serotonin receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	21056967
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007165	Process	Signal transduction	TAS	1411529
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IBA	21873635
GO:0007197	Process	Adenylate cyclase-inhibiting G protein-coupled acetylcholine receptor signaling pathway	IBA	21873635
GO:0007205	Process	Protein kinase C-activating G protein-coupled receptor signaling pathway	TAS	9603968
GO:0007207	Process	Phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway	TAS	8139539
GO:0007213	Process	G protein-coupled acetylcholine receptor signaling pathway	TAS	8139539
GO:0007268	Process	Chemical synaptic transmission	IBA	21873635
GO:0007274	Process	Neuromuscular synaptic transmission	IEA
GO:0007399	Process	Nervous system development	TAS	2739737
GO:0016020	Component	Membrane	TAS	7925360
GO:0016907	Function	G protein-coupled acetylcholine receptor activity	IBA	21873635
GO:0030425	Component	Dendrite	IBA	21873635
GO:0030594	Function	Neurotransmitter receptor activity	IBA	21873635
GO:0040012	Process	Regulation of locomotion	IEA
GO:0043270	Process	Positive regulation of ion transport	IGI	14657398
GO:0043679	Component	Axon terminus	IEA
GO:0045202	Component	Synapse	IBA	21873635
GO:0046541	Process	Saliva secretion	IEA
GO:0050890	Process	Cognition	IEA
GO:0060078	Process	Regulation of postsynaptic membrane potential	IEA
GO:0060251	Process	Regulation of glial cell proliferation	TAS	2739737
GO:0090316	Process	Positive regulation of intracellular protein transport	IEA
GO:0098664	Process	G protein-coupled serotonin receptor signaling pathway	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098981	Component	Cholinergic synapse	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:0099529	Function	Neurotransmitter receptor activity involved in regulation of postsynaptic membrane potential	IEA

MIM	HGNC	e!Ensembl
118510	1950	ENSG00000168539

Protein

UniProt ID

P11229

Protein name

Muscarinic acetylcholine receptor M1

Protein function

The muscarinic acetylcholine receptor mediates various cellular responses, including inhibition of adenylate cyclase, breakdown of phosphoinositides and modulation of potassium channels through the action of G proteins. Primary transducing effec

PDB

5CXV , 6OIJ , 6WJC , 6ZFZ , 6ZG4 , 6ZG9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	42 → 418	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC

Sequence length

460

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway cAMP signaling pathway Neuroactive ligand-receptor interaction PI3K-Akt signaling pathway Cholinergic synapse Regulation of actin cytoskeleton Alzheimer disease Pathways of neurodegeneration - multiple diseases		Muscarinic acetylcholine receptors G alpha (q) signalling events

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Epilepsy	Epilepsy, Epilepsy, Cryptogenic, Awakening Epilepsy	rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670 View all (165 more)	18333967
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	22391213, 14504414, 23423139, 18317461
Seizure	Complex partial seizures, Generalized seizures, Visual seizure, Tonic - clonic seizures, Single Seizure	rs587784365, rs28939683, rs74315390, rs28939684, rs74315391, rs267607198, rs74315392, rs118192244, rs118192250, rs121917749, rs121917750, rs121917751, rs121917752, rs267606670, rs267607061 View all (179 more)	11392617, 12091480, 12713643, 10069499, 8028781

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Mental retardation	intellectual disability	GenCC
Insomnia	Insomnia	GWAS

Show/Hide Text Mining Associations (32)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	18414411
alpha 1 Antitrypsin Deficiency	Stimulate	2309708, 3040726
alpha 1 Antitrypsin Deficiency	Associate	2309708
Alzheimer Disease	Inhibit	36475335
Asthma	Associate	16931638
Carcinoma Renal Cell	Inhibit	31862408
Colorectal Neoplasms	Associate	25408579
Developmental Disabilities	Associate	34212451
Drug Resistant Epilepsy	Associate	34212451
Dyskinesia Drug Induced	Associate	30623717
Epilepsy	Associate	34212451
Hypoxia	Associate	31862408
Ige Responsiveness Atopic	Associate	16931638
Inflammation	Associate	16931638
Intellectual Disability	Associate	34212451
Medulloblastoma	Associate	18952980
Mitochondrial Diseases	Associate	36002781
Myopia	Associate	19753311
Nerve Degeneration	Associate	36002781
Neural Tube Defects	Stimulate	33491544
Neuralgia	Associate	36002781
Ocular Albinism type 1	Associate	3040726
Peripheral Nervous System Diseases	Associate	36002781
Prostatic Neoplasms	Associate	30027929, 32205868
Prostatic Neoplasms Castration Resistant	Associate	32205868
REM Sleep Parasomnias	Associate	36475335
Seizures	Associate	34212451
Sensation Disorders	Associate	36002781
Sleep Wake Disorders	Associate	36475335
Small Fiber Neuropathy	Associate	36002781
Stomach Neoplasms	Associate	31322220
Urinary Bladder Neoplasms	Associate	24914957

CHRM1 (cholinergic receptor muscarinic 1)