Gene Gene information from NCBI Gene database.
Entrez ID 11279
Gene name KLF transcription factor 8
Gene symbol KLF8
Synonyms (NCBI Gene)
BKLF3ZNF741
Chromosome X
Chromosome location Xp11.21
Summary This gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in t
miRNA miRNA information provided by mirtarbase database.
451
miRTarBase ID miRNA Experiments Reference
MIRT017467 hsa-miR-335-5p Microarray 18185580
MIRT656835 hsa-miR-5571-5p HITS-CLIP 23824327
MIRT676352 hsa-miR-6819-3p HITS-CLIP 23824327
MIRT676351 hsa-miR-6877-3p HITS-CLIP 23824327
MIRT661727 hsa-miR-6840-3p HITS-CLIP 23824327
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
SP1 Unknown 18353772
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 10756197
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10756197
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300286 6351 ENSG00000102349
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95600
Protein name Krueppel-like factor 8 (Basic krueppel-like factor 3) (Zinc finger protein 741)
Protein function Transcriptional repressor and activator. Binds to CACCC-boxes promoter elements. Also binds the GT-box of cyclin D1 promoter and mediates cell cycle progression at G(1) phase as a downstream target of focal adhesion kinase (FAK). {ECO:0000269|Pu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 274 298 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 304 328 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 334 356 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10756197}.
Sequence
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENP
ALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTL
VVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPV
VVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESG
SSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTG
EKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM
Sequence length 359
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
13
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs189635205 RCV005902689
Cervical cancer Benign rs189635205 RCV005902691
Chronic lymphocytic leukemia/small lymphocytic lymphoma Benign rs189635205 RCV005902698
Familial cancer of breast Benign rs146429909, rs189635205 RCV005892319
RCV005902687
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 21151179, 22276196
Breast Neoplasms Inhibit 31640084
Carcinogenesis Associate 23504025, 23722127
Carcinoma Hepatocellular Associate 22276196, 22761862
Carcinoma Non Small Cell Lung Stimulate 28986741
Carcinoma Ovarian Epithelial Associate 18353772
Carcinoma Renal Cell Associate 22276196
Carcinoma Renal Cell Stimulate 25040744
Glioma Associate 22276196
Hypoxia Stimulate 25040744