Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11279
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF8
Synonyms (NCBI Gene) Gene synonyms aliases
BKLF3, ZNF741
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xp11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in t
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017467 hsa-miR-335-5p Microarray 18185580
MIRT656835 hsa-miR-5571-5p HITS-CLIP 23824327
MIRT676352 hsa-miR-6819-3p HITS-CLIP 23824327
MIRT676351 hsa-miR-6877-3p HITS-CLIP 23824327
MIRT661727 hsa-miR-6840-3p HITS-CLIP 23824327
Transcription factors
Transcription factor Regulation Reference
SP1 Unknown 18353772
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 10756197
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10756197
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300286 6351 ENSG00000102349
Protein
UniProt ID O95600
Protein name Krueppel-like factor 8 (Basic krueppel-like factor 3) (Zinc finger protein 741)
Protein function Transcriptional repressor and activator. Binds to CACCC-boxes promoter elements. Also binds the GT-box of cyclin D1 promoter and mediates cell cycle progression at G(1) phase as a downstream target of focal adhesion kinase (FAK). {ECO:0000269|Pu
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 274 298 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 304 328 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 334 356 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10756197}.
Sequence
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENP
ALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTL
VVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPV
VVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESG
SSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTG
EKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM
Sequence length 359
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Mental retardation Intellectual Disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
11836360
Unknown
Disease term Disease name Evidence References Source
Neuroticism Neuroticism GWAS
Hypogonadism Hypogonadism GWAS
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 21151179, 22276196
Breast Neoplasms Inhibit 31640084
Carcinogenesis Associate 23504025, 23722127
Carcinoma Hepatocellular Associate 22276196, 22761862
Carcinoma Non Small Cell Lung Stimulate 28986741
Carcinoma Ovarian Epithelial Associate 18353772
Carcinoma Renal Cell Associate 22276196
Carcinoma Renal Cell Stimulate 25040744
Glioma Associate 22276196
Hypoxia Stimulate 25040744