Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11278
Gene name Gene Name - the full gene name approved by the HGNC.
KLF transcription factor 12
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLF12
Synonyms (NCBI Gene) Gene synonyms aliases
AP-2rep, AP2REP, HSPC122
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc f
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT027368 hsa-miR-101-3p Sequencing 20371350
MIRT050396 hsa-miR-23a-3p CLASH 23622248
MIRT536465 hsa-miR-6773-3p PAR-CLIP 20371350
MIRT536463 hsa-miR-215-3p PAR-CLIP 20371350
MIRT536461 hsa-miR-6888-3p PAR-CLIP 20371350
Transcription factors
Transcription factor Regulation Reference
TFAP2A Repression 10704285
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10704285, 16615998
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10704285
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607531 6346 ENSG00000118922
Protein
UniProt ID Q9Y4X4
Protein name Krueppel-like factor 12 (Transcriptional repressor AP-2rep)
Protein function Confers strong transcriptional repression to the AP-2-alpha gene. Binds to a regulatory element (A32) in the AP-2-alpha gene promoter.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 317 341 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 347 371 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 377 399 Zinc finger, C2H2 type Domain
Sequence
MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNN
VKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSPVSMTASASSPSSTSTSSSSS
SRLASSPTVITSVSSASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKL
SHVHRIPVVVQSVPVVYTAVRSPGNVNNTIVVPLLEDGRGHGKAQMDPRGLSPRQSKSDS
DDDDLPNVTLDSVNETGSTALSIARAVQEVHPSPVSRVRGNRMNNQKFPCSISPFSIEST
RRQRRSESPDSRKRRIHRCDFEGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFAR
SDELTRHYRKH
TGVKPFKCADCDRSFSRSDHLALHRRRHMLV
Sequence length 402
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
26198764, 21822266
Unknown
Disease term Disease name Evidence References Source
Mental depression Major Depressive Disorder 29071344 ClinVar
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Coenzyme Q10 Deficiency Coenzyme Q10 Deficiency GWAS
Bronchopulmonary Dysplasia Bronchopulmonary Dysplasia GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Stimulate 27442508
Adenocarcinoma of Lung Associate 34644678
Arthritis Rheumatoid Associate 18668548
Breast Neoplasms Associate 27832451
Breast Neoplasms Stimulate 37156774
Carcinoma Renal Cell Associate 35787628
Colorectal Neoplasms Associate 27442508, 29700213
Long QT Syndrome Associate 32429735
Neoplasm Metastasis Associate 36272152
Neoplasms Stimulate 26183718