Gene Gene information from NCBI Gene database.
Entrez ID 11278
Gene name KLF transcription factor 12
Gene symbol KLF12
Synonyms (NCBI Gene)
AP-2repAP2REPHSPC122
Chromosome 13
Chromosome location 13q22.1
Summary Activator protein-2 alpha (AP-2 alpha) is a developmentally-regulated transcription factor and important regulator of gene expression during vertebrate development and carcinogenesis. The protein encoded by this gene is a member of the Kruppel-like zinc f
miRNA miRNA information provided by mirtarbase database.
774
miRTarBase ID miRNA Experiments Reference
MIRT027368 hsa-miR-101-3p Sequencing 20371350
MIRT050396 hsa-miR-23a-3p CLASH 23622248
MIRT536465 hsa-miR-6773-3p PAR-CLIP 20371350
MIRT536463 hsa-miR-215-3p PAR-CLIP 20371350
MIRT536461 hsa-miR-6888-3p PAR-CLIP 20371350
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Transcription factor Regulation Reference
TFAP2A Repression 10704285
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 16615998
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10704285
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607531 6346 ENSG00000118922
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y4X4
Protein name Krueppel-like factor 12 (Transcriptional repressor AP-2rep)
Protein function Confers strong transcriptional repression to the AP-2-alpha gene. Binds to a regulatory element (A32) in the AP-2-alpha gene promoter.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 317 341 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 347 371 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 377 399 Zinc finger, C2H2 type Domain
Sequence
MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNN
VKGEPPEDSLSVDHFQTQTEPVDLSINKARTSPTAVSSSPVSMTASASSPSSTSTSSSSS
SRLASSPTVITSVSSASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKL
SHVHRIPVVVQSVPVVYTAVRSPGNVNNTIVVPLLEDGRGHGKAQMDPRGLSPRQSKSDS
DDDDLPNVTLDSVNETGSTALSIARAVQEVHPSPVSRVRGNRMNNQKFPCSISPFSIEST
RRQRRSESPDSRKRRIHRCDFEGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFAR
SDELTRHYRKH
TGVKPFKCADCDRSFSRSDHLALHRRRHMLV
Sequence length 402
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hepatocellular carcinoma Uncertain significance rs201686630 RCV005932326
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Stimulate 27442508
Adenocarcinoma of Lung Associate 34644678
Arthritis Rheumatoid Associate 18668548
Breast Neoplasms Associate 27832451
Breast Neoplasms Stimulate 37156774
Carcinoma Renal Cell Associate 35787628
Colorectal Neoplasms Associate 27442508, 29700213
Long QT Syndrome Associate 32429735
Neoplasm Metastasis Associate 36272152
Neoplasms Stimulate 26183718