Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	112744
Gene name	Interleukin 17F
Gene symbol	IL17F
Synonyms (NCBI Gene)	CANDF6IL-17FIL17AML-1ML1
Chromosome	6
Chromosome location	6p12.2
Summary	The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs748486078	G>A	Pathogenic	Coding sequence variant, missense variant

Show/Hide all (11)

miRTarBase ID	miRNA	Experiments
MIRT1063812	hsa-miR-1207-3p	CLIP-seq
MIRT1063813	hsa-miR-139-5p	CLIP-seq
MIRT739491	hsa-miR-2467-3p	CLIP-seq
MIRT739492	hsa-miR-3678-3p	CLIP-seq
MIRT1063814	hsa-miR-3681	CLIP-seq
MIRT1063815	hsa-miR-4481	CLIP-seq
MIRT739493	hsa-miR-4684-3p	CLIP-seq
MIRT1063816	hsa-miR-4745-5p	CLIP-seq
MIRT1063817	hsa-miR-4758-5p	CLIP-seq
MIRT1063818	hsa-miR-4778-3p	CLIP-seq
MIRT739490	hsa-miR-555	CLIP-seq

Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IDA	11591732
GO:0002225	Process	Positive regulation of antimicrobial peptide production	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005125	Function	Cytokine activity	IDA	11591732
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28827714
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	11591732
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IDA	11591732
GO:0019955	Function	Cytokine binding	IDA	11574464
GO:0032645	Process	Regulation of granulocyte macrophage colony-stimulating factor production	IDA	11574464
GO:0032663	Process	Regulation of interleukin-2 production	IDA	11591732
GO:0032675	Process	Regulation of interleukin-6 production	IDA	11574464
GO:0032677	Process	Regulation of interleukin-8 production	IDA	11574464
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	21350122
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032761	Process	Positive regulation of lymphotoxin A production	IDA	11591732
GO:0042803	Function	Protein homodimerization activity	IDA	11574464
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051216	Process	Cartilage development	IDA	11574464
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IDA	21350122
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1903557	Process	Positive regulation of tumor necrosis factor superfamily cytokine production	IEA
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	IDA	21350122
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	IEA

MIM	HGNC	e!Ensembl
606496	16404	ENSG00000112116

Q96PD4

Protein name

Interleukin-17F (IL-17F) (Cytokine ML-1)

Protein function

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed:21350122). IL17A-IL17F signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic inter

PDB

1JPY , 3JVF , 5N92 , 5NAN , 6HG4 , 6HG9 , 6HGO , 6PPG , 8RUU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06083	IL17	77 → 155	Interleukin-17	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in T-helper 1 and T-helper 2 cells, basophils and mast cells. {ECO:0000269|PubMed:11591768}.

Sequence

MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIG
IINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNS
VPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Sequence length

163

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction IL-17 signaling pathway Th17 cell differentiation Inflammatory bowel disease		Interleukin-17 signaling Interleukin-4 and Interleukin-13 signaling

138

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Candidiasis, familial, 6	Uncertain significance; Likely benign; Conflicting classifications of pathogenicity; Benign	rs144576902, rs769299818, rs1763973005, rs141798304, rs1763976446, rs550486674, rs766577007, rs536968854, rs137981743, rs2128267440, rs2128267452, rs374833689, rs371280410, rs1436156723, rs969467406 View all (111 more)	RCV001327195 RCV001318520 RCV001338958 RCV001340518 RCV001341910 RCV001344765 RCV001363432 RCV001454674 RCV001451270 RCV001489406 RCV001495415 RCV001489039 RCV001939836 RCV001943178 RCV002015076 RCV001918984 RCV001875382 RCV001864992 RCV001899950 RCV002025558 RCV001927761 RCV001914745 RCV001988577 RCV001949101 RCV001998998 RCV002046767 RCV001909269 RCV002016005 RCV001955134 RCV002009988 RCV002092571 RCV002177590 RCV002080438 RCV002111236 RCV002140194 RCV002170166 RCV002147623 RCV003083931 RCV002611969 RCV002647790 RCV003114991 RCV003121569 RCV003115875 RCV002631020 RCV002643173 RCV002800340 RCV002806009 RCV002766614 RCV002780492 RCV002834168 RCV002913030 RCV002900293 RCV002962494 RCV002999268 RCV003002672 RCV002994858 RCV003057662 RCV003033166 RCV003055838 RCV005099711 RCV000490407 RCV003142510 RCV003133699 RCV003641092 RCV003525518 RCV003526831 RCV003527151 RCV003527442 RCV003527581 RCV003526585 RCV003641640 RCV003641665 RCV003641565 RCV000312054 RCV000533921 RCV000375090 RCV003641844 RCV003640654 RCV000277771 RCV000369036 RCV000381916 RCV003640721 RCV003640813 RCV003641891 RCV003642052 RCV003642073 RCV003642358 RCV003642308 RCV003642201 RCV003641372 RCV000370210 RCV000648861 RCV000284057 RCV000272022 RCV000376143 RCV000336789 RCV003817482 RCV003815024 RCV003844766 RCV003857765 RCV003861257 RCV003872256 RCV000023553 RCV000558026 RCV000648862 RCV001466690 RCV000697976 RCV000690276 RCV000707054 RCV000817902 RCV000800724 RCV000802633 RCV001405548 RCV000942390 RCV001426574 RCV001045210 RCV001057068 RCV001053913 RCV001065751 RCV001047528 RCV001161955 RCV001163971 RCV001159050 RCV001163972 RCV001163973 RCV001215590 RCV001217422 RCV001220305 RCV001213344 RCV001233288 RCV001229184 RCV001228227 RCV001231704 RCV001238951 RCV001245270
Familial pancreatic carcinoma	Conflicting classifications of pathogenicity	rs117796773	RCV005893887
Gastric cancer	Conflicting classifications of pathogenicity	rs117796773	RCV005893888
IL17F-related disorder	Benign	rs11465553	RCV003972504

Show/Hide Text Mining Associations (149)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Spontaneous	Stimulate	33731680
Adenocarcinoma Follicular	Associate	19652218
Arthritis Psoriatic	Associate	25146432, 29849482, 32138573, 34011674
Arthritis Rheumatoid	Associate	19234208, 20618772, 25146432, 26062018, 28547498, 31316164, 37751416
Arthritis Rheumatoid	Stimulate	27926504
Asthma	Associate	11591768, 19251839, 20538817, 22312940, 22812194, 25394579, 27931975, 28474507, 28606156, 29968887, 31439682, 35325374
Asthma	Stimulate	22312940, 30304965
Atrophy	Associate	30961540
Autism Spectrum Disorder	Associate	38288647
Autoimmune Diseases	Associate	22184122, 26062018, 26620416, 30979797
Axial Spondyloarthritis	Associate	36995469
Breast Neoplasms	Associate	22461912
Candidiasis Chronic Mucocutaneous	Associate	20123959, 21535082, 31784499
Carcinoma Hepatocellular	Associate	34190694, 39873997
Cardiomyopathies	Associate	28470012
Chagas Cardiomyopathy	Associate	28470012
Chagas Disease	Associate	28470012
Chemical and Drug Induced Liver Injury	Associate	36483566
Chronic Disease	Associate	20618772
Chronic Periodontitis	Associate	23304063, 25525302, 26096103, 26924897, 37347817
Colitis Ulcerative	Associate	29548809, 31191543
Colorectal Neoplasms	Associate	25296730, 26083022, 26304506, 28347290, 29874787, 29970680, 36422171
Colorectal Neoplasms	Inhibit	29548809
Common Variable Immunodeficiency	Associate	32047491
Complex Regional Pain Syndromes	Associate	31217010
COVID 19	Associate	34081354, 35264675, 36349054, 37483627
COVID 19	Stimulate	39493750
Crohn Disease	Associate	26558270, 31191543, 33663574
Cystic Fibrosis	Associate	15972674
Cytokine Release Syndrome	Associate	33402994
Dermatitis Allergic Contact	Stimulate	19785613
Dermatitis Atopic	Inhibit	26682905
Dermatitis Atopic 1	Associate	25394579
Dermatitis Atopic 3	Associate	28606156, 29968887
Dermatomyositis	Associate	27803134
Diabetes Gestational	Stimulate	35304898
Diabetes Mellitus	Stimulate	25363329
Diabetes Mellitus	Associate	26400516
Diabetes Mellitus Type 1	Associate	26924897
Diabetes Mellitus Type 2	Stimulate	34079246
Drug Hypersensitivity	Associate	11591768, 28606156
Duodenal Diseases	Associate	23012664
Endometriosis	Associate	21601196
Enterocolitis Necrotizing	Associate	33663574
Enterovirus Infections	Associate	29549443
Familial antiphospholipid syndrome	Associate	27320770
Fatigue Syndrome Chronic	Associate	25514671
Fibrosis	Associate	30961540, 40332363
Gout	Inhibit	26890073
Graft vs Host Disease	Inhibit	36056390
Granulosa cell tumor of the ovary	Associate	35325374
Graves Disease	Associate	22816799
Hashimoto Disease	Associate	22816799, 35767887
Helicobacter Infections	Stimulate	21044126
Helicobacter Infections	Associate	26151690
Hematologic Neoplasms	Associate	37505775
Hepatitis B	Associate	34190694, 37585994
Hepatitis C Chronic	Associate	39873997
Herpes Labialis	Associate	32735468
Hidradenitis Suppurativa	Associate	37271319
Hip Injuries	Associate	29194748, 31042000
HIV Infections	Associate	30951887
Hypoproteinemia	Associate	36483566
Ichthyosis	Stimulate	29803800
Idiopathic Noncirrhotic Portal Hypertension	Associate	34190694
Infertility	Associate	39580416
Infertility Female	Associate	39580416
Inflammation	Associate	19251839, 20538817, 21479174, 22461912, 24621498, 25451162, 26151690, 28474507, 28606156, 28739826, 29194748, 30972071, 31379807, 32360069, 32737987 View all (5 more)
Inflammation	Stimulate	33453290
Inflammatory Bowel Diseases	Associate	33663574
Keratoderma Palmoplantar	Associate	30484821
Laryngeal Neoplasms	Associate	28362993
Leprosy	Associate	35462022
Leukemia Lymphocytic Chronic B Cell	Associate	26478573, 35511436
Leukemia Lymphoma Adult T Cell	Associate	29794791
Leukemia Myeloid Acute	Associate	24793548, 26191290, 37505775
Liver Cirrhosis	Associate	40332363
Lung Neoplasms	Associate	31059089
Lupus Erythematosus Systemic	Stimulate	22038405
Lupus Erythematosus Systemic	Inhibit	22184122
Lupus Erythematosus Systemic	Associate	24433387, 24598455, 26079624, 26515887, 27320770, 33882880, 34596026
Lupus Nephritis	Associate	26515887
Lymphoma	Associate	35971833
Lymphoma Large Cell Anaplastic	Associate	29588546
Lymphoma Mantle Cell	Associate	33648463
Lymphoma T Cell Cutaneous	Associate	20233883, 23801634, 29794791, 35971833
Malaria Cerebral	Associate	26667835
Mucocutaneous Lymph Node Syndrome	Stimulate	25605650, 37610270
Multiple Sclerosis	Stimulate	21189442
Multiple Sclerosis Relapsing Remitting	Stimulate	35328606
Mycosis Fungoides	Associate	24621498, 29794791
Mycosis Fungoides	Inhibit	33170303
Neointima	Associate	32723833
Neoplasms	Associate	22142827, 22461912, 25012243, 26083022, 27993206, 28362993, 32047491, 37505775, 39873997
Neoplasms	Inhibit	29970680
Neutrophil Immunodeficiency Syndrome	Associate	20538817
Neutrophilia Hereditary	Associate	25394579
Obesity	Associate	32849611
Obesity Maternal	Stimulate	35304898
Osteoarthritis	Associate	25146432, 29194748, 30658595, 34054865
Osteoarthritis Hip	Associate	29194748, 31042000
Osteoarthritis Knee	Associate	30658595
Osteomyelitis	Associate	32454789
Osteosarcoma	Associate	32723833
Pancreatic Neoplasms	Associate	22142827
Pemphigoid Bullous	Associate	30484821, 33340282
Pemphigus	Associate	30116153
Peptic Ulcer	Associate	23012664
Periodontitis	Associate	25525302, 26339129
Persian Gulf Syndrome	Associate	25514671
Personality Disorders	Stimulate	27144517
Pleural Effusion	Associate	27586092
Polyendocrinopathies Autoimmune	Associate	20123959, 21535082, 30979797
Polyps	Associate	29548809
Pre Eclampsia	Associate	26119194
Prostatic Hyperplasia	Associate	27716046
Prostatic Neoplasms	Associate	27716046, 32537467
Psoriasis	Associate	29803800, 32360069, 37271319
Pulmonary Disease Chronic Obstructive	Stimulate	21477350
Pulmonary Disease Chronic Obstructive	Associate	25427574, 34079246
Purpura Thrombocytopenic Idiopathic	Stimulate	25621490
Purpura Thrombocytopenic Idiopathic	Associate	26620416
Rectal Neoplasms	Associate	29874787
Scleroderma Systemic	Inhibit	25136988
Scleroderma Systemic	Associate	30641535
Severe Acute Respiratory Syndrome	Associate	25394579, 29549443
Sezary Syndrome	Associate	35971833
Silicosis	Associate	25374205
Sjogren's Syndrome	Associate	34596026
Skin Diseases	Associate	24621498
Spondylitis Ankylosing	Associate	29849482, 32360069, 34290697, 34744511
Squamous Cell Carcinoma of Head and Neck	Associate	36529525
Status Asthmaticus	Associate	11591768, 28606156, 32849611
Stomach Neoplasms	Associate	24218334, 25012243, 26261639, 26535650, 27097946, 27525907
Stomatitis Aphthous	Associate	33351682
Sutton disease 2	Associate	33351682
Thrombocytopenia	Associate	26620416
Thyroid Neoplasms	Associate	23867310
Thyroiditis Autoimmune	Associate	22816799, 35767887
Tn Syndrome	Associate	35511436
Tuberculosis	Associate	25363329, 26345782, 27339100
Tuberculosis Meningeal	Associate	26045845
Tuberculosis Pulmonary	Associate	26045845, 27339100, 36483566
Ulcer	Associate	23012664
Urinary Bladder Neoplasms	Stimulate	27716046
Uterine Cervical Neoplasms	Associate	23049595, 25596084, 26464720, 26505366
Uveitis	Stimulate	27028890
Uveitis Anterior	Associate	31763950
Ventricular Dysfunction Left	Associate	28470012

IL17F (interleukin 17F)