Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	112744
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 17F
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL17F
Synonyms (NCBI Gene) Gene synonyms aliases	CANDF6, IL-17F, IL17A, ML-1, ML1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p12.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs748486078	G>A	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(11)

miRTarBase ID	miRNA	Experiments
MIRT1063812	hsa-miR-1207-3p	CLIP-seq
MIRT1063813	hsa-miR-139-5p	CLIP-seq
MIRT739491	hsa-miR-2467-3p	CLIP-seq
MIRT739492	hsa-miR-3678-3p	CLIP-seq
MIRT1063814	hsa-miR-3681	CLIP-seq
MIRT1063815	hsa-miR-4481	CLIP-seq
MIRT739493	hsa-miR-4684-3p	CLIP-seq
MIRT1063816	hsa-miR-4745-5p	CLIP-seq
MIRT1063817	hsa-miR-4758-5p	CLIP-seq
MIRT1063818	hsa-miR-4778-3p	CLIP-seq
MIRT739490	hsa-miR-555	CLIP-seq

Show/Hide all(37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001819	Process	Positive regulation of cytokine production	IDA	11591732
GO:0002225	Process	Positive regulation of antimicrobial peptide production	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005125	Function	Cytokine activity	IDA	11591732
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28827714
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	11591732
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IDA	11591732
GO:0019955	Function	Cytokine binding	IDA	11574464
GO:0032645	Process	Regulation of granulocyte macrophage colony-stimulating factor production	IDA	11574464
GO:0032663	Process	Regulation of interleukin-2 production	IDA	11591732
GO:0032675	Process	Regulation of interleukin-6 production	IDA	11574464
GO:0032677	Process	Regulation of interleukin-8 production	IDA	11574464
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	21350122
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032761	Process	Positive regulation of lymphotoxin A production	IDA	11591732
GO:0042803	Function	Protein homodimerization activity	IDA	11574464
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0050829	Process	Defense response to Gram-negative bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0051216	Process	Cartilage development	IDA	11574464
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IDA	21350122
GO:0097400	Process	Interleukin-17-mediated signaling pathway	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1903557	Process	Positive regulation of tumor necrosis factor superfamily cytokine production	IEA
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	IDA	21350122
GO:2000340	Process	Positive regulation of chemokine (C-X-C motif) ligand 1 production	IEA

MIM	HGNC	e!Ensembl
606496	16404	ENSG00000112116

Protein

UniProt ID

Q96PD4

Protein name

Interleukin-17F (IL-17F) (Cytokine ML-1)

Protein function

Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed:21350122). IL17A-IL17F signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic inter

PDB

1JPY , 3JVF , 5N92 , 5NAN , 6HG4 , 6HG9 , 6HGO , 6PPG , 8RUU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06083	IL17	77 → 155	Interleukin-17	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in T-helper 1 and T-helper 2 cells, basophils and mast cells. {ECO:0000269|PubMed:11591768}.

Sequence

MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIG
IINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNS
VPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ

Sequence length

163

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction IL-17 signaling pathway Th17 cell differentiation Inflammatory bowel disease		Interleukin-17 signaling Interleukin-4 and Interleukin-13 signaling

IL17F (interleukin 17F)