Gene Gene information from NCBI Gene database.
Entrez ID 11270
Gene name Nurim
Gene symbol NRM
Synonyms (NCBI Gene)
NRM29
Chromosome 6
Chromosome location 6p21.33
Summary The protein encoded by this gene contains transmembrane domains and resides within the inner nuclear membrane, where it is tightly associated with the nucleus. This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternati
miRNA miRNA information provided by mirtarbase database.
167
miRTarBase ID miRNA Experiments Reference
MIRT439154 hsa-let-7c-5p 3'LIFE 25074381
MIRT439154 hsa-let-7c-5p 3'LIFE 25074381
MIRT1194265 hsa-miR-1236 CLIP-seq
MIRT1194266 hsa-miR-1245b-3p CLIP-seq
MIRT1194267 hsa-miR-1253 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 31515488, 32296183
GO:0005634 Component Nucleus IEA
GO:0005635 Component Nuclear envelope IDA 10402458
GO:0005637 Component Nuclear inner membrane IEA
GO:0016020 Component Membrane HDA 19946888
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
620017 8003 ENSG00000137404
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IXM6
Protein name Nurim (Nuclear envelope membrane protein) (Nuclear rim protein)
Family and domains
Sequence
MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSIL
APLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIP
KGPVLWEARAEPWATWVPLLCFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEP
LALKSPRALRLFSHLRHPVCVELLTVLWVVPTLGTDRLLLAFLLTLYLGLAHGLDQQDLR
YLRAQLQRKLHLLSRPQDGEAE
Sequence length 262
Interactions View interactions