Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	112616
Gene name	CKLF like MARVEL transmembrane domain containing 7
Gene symbol	CMTM7
Synonyms (NCBI Gene)	CKLFSF7
Chromosome	3
Chromosome location	3p22.3
Summary	This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene act

Show/Hide all (43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022306	hsa-miR-124-3p	Microarray	18668037
MIRT899196	hsa-miR-1271	CLIP-seq
MIRT899197	hsa-miR-182	CLIP-seq
MIRT899198	hsa-miR-3660	CLIP-seq
MIRT899199	hsa-miR-4293	CLIP-seq
MIRT899200	hsa-miR-4526	CLIP-seq
MIRT899201	hsa-miR-4700-3p	CLIP-seq
MIRT899202	hsa-miR-873	CLIP-seq
MIRT899203	hsa-miR-96	CLIP-seq
MIRT899204	hsa-miR-139-5p	CLIP-seq
MIRT899205	hsa-miR-3622a-5p	CLIP-seq
MIRT899206	hsa-miR-3667-5p	CLIP-seq
MIRT899207	hsa-miR-3675-3p	CLIP-seq
MIRT899208	hsa-miR-4255	CLIP-seq
MIRT899209	hsa-miR-4269	CLIP-seq
MIRT899210	hsa-miR-4438	CLIP-seq
MIRT899211	hsa-miR-5095	CLIP-seq
MIRT899212	hsa-miR-583	CLIP-seq
MIRT899202	hsa-miR-873	CLIP-seq
MIRT2202494	hsa-miR-1343	CLIP-seq
MIRT2202495	hsa-miR-2278	CLIP-seq
MIRT2202496	hsa-miR-3124-3p	CLIP-seq
MIRT2202497	hsa-miR-3170	CLIP-seq
MIRT2202498	hsa-miR-3192	CLIP-seq
MIRT2202499	hsa-miR-3714	CLIP-seq
MIRT2202500	hsa-miR-4476	CLIP-seq
MIRT2202501	hsa-miR-4487	CLIP-seq
MIRT2202502	hsa-miR-4777-5p	CLIP-seq
MIRT2202503	hsa-miR-516a-3p	CLIP-seq
MIRT2202504	hsa-miR-518d-5p	CLIP-seq
MIRT2202505	hsa-miR-519b-5p	CLIP-seq
MIRT2202506	hsa-miR-519c-5p	CLIP-seq
MIRT2202507	hsa-miR-520c-5p	CLIP-seq
MIRT2202508	hsa-miR-526a	CLIP-seq
MIRT2202509	hsa-miR-544b	CLIP-seq
MIRT2202510	hsa-miR-570	CLIP-seq
MIRT2202511	hsa-miR-876-3p	CLIP-seq
MIRT2202496	hsa-miR-3124-3p	CLIP-seq
MIRT2447285	hsa-miR-3160-5p	CLIP-seq
MIRT2447286	hsa-miR-3612	CLIP-seq
MIRT2447287	hsa-miR-4443	CLIP-seq
MIRT2447288	hsa-miR-485-5p	CLIP-seq
MIRT2447289	hsa-miR-650	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002337	Process	B-1a B cell differentiation	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
607890	19178	ENSG00000153551

Q96FZ5

Protein name

CKLF-like MARVEL transmembrane domain-containing protein 7 (Chemokine-like factor superfamily member 7)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01284	MARVEL	40 → 160	Membrane-associating domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in leukocytes. {ECO:0000269|PubMed:12782130}.

Sequence

MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAF
ICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGT
LLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV

Sequence length

175

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	32568178, 35575054	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	36829181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Inhibit	30903681	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	36975415	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Inhibit	30903681	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	30903681, 36829181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	32111069	★★★★★ ★☆☆☆☆ Found in Text Mining only

CMTM7 (CKLF like MARVEL transmembrane domain containing 7)