CHP1 (calcineurin like EF-hand protein 1)

Gene

• Entrez ID: 11261
• Gene name: Calcineurin like EF-hand protein 1
• Gene symbol: CHP1
• Synonyms (NCBI Gene): CHP, SLC9A1BP, SPAX9, Sid470p, p22, p24
• Disease Acronyms (UniProt): SPAX9
• Chromosome: 15
• Chromosome location: 15q15.1
• Summary: This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein s

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT031773	hsa-miR-16-5p	Proteomics	18668040

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	ISS
GO:0001578	Process	Microtubule bundle formation	ISS
GO:0001933	Process	Negative regulation of protein phosphorylation	ISS
GO:0004860	Function	Protein kinase inhibitor activity	IEA
GO:0005509	Function	Calcium ion binding	IDA	15035633
GO:0005515	Function	Protein binding	IPI	8901634, 10593895, 11350981, 15035633, 30177828, 31912575
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	11350981, 15035633
GO:0005886	Component	Plasma membrane	IMP	29379881
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006469	Process	Negative regulation of protein kinase activity	ISS
GO:0006611	Process	Protein export from nucleus	ISS
GO:0006813	Process	Potassium ion transport	TAS	8901634
GO:0006903	Process	Vesicle targeting	IEA
GO:0006906	Process	Vesicle fusion	IEA
GO:0007264	Process	Small GTPase mediated signal transduction	TAS	8901634
GO:0008017	Function	Microtubule binding	ISS
GO:0010923	Process	Negative regulation of phosphatase activity	IDA	10593895
GO:0015459	Function	Potassium channel regulator activity	TAS	8901634
GO:0015630	Component	Microtubule cytoskeleton	ISS
GO:0019900	Function	Kinase binding	ISS
GO:0022406	Process	Membrane docking	ISS
GO:0030133	Component	Transport vesicle	ISS
GO:0030214	Process	Hyaluronan catabolic process	TAS
GO:0031122	Process	Cytoplasmic microtubule organization	ISS
GO:0031397	Process	Negative regulation of protein ubiquitination	ISS
GO:0031953	Process	Negative regulation of protein autophosphorylation	ISS
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	10593895
GO:0032417	Process	Positive regulation of sodium:proton antiporter activity	IDA	8901634, 11350981
GO:0032417	Process	Positive regulation of sodium:proton antiporter activity	ISS
GO:0042308	Process	Negative regulation of protein import into nucleus	IDA	10593895
GO:0048306	Function	Calcium-dependent protein binding	IDA	15035633
GO:0050821	Process	Protein stabilization	ISS
GO:0051222	Process	Positive regulation of protein transport	ISS
GO:0051259	Process	Protein complex oligomerization	IEA
GO:0051453	Process	Regulation of intracellular pH	IDA	8901634, 15035633
GO:0060050	Process	Positive regulation of protein glycosylation	ISS
GO:0061024	Process	Membrane organization	ISS
GO:0061025	Process	Membrane fusion	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070885	Process	Negative regulation of calcineurin-NFAT signaling cascade	IDA	10593895
GO:0071073	Process	Positive regulation of phospholipid biosynthetic process	IMP	30846317
GO:0071468	Process	Cellular response to acidic pH	ISS
GO:0090314	Process	Positive regulation of protein targeting to membrane	ISS
GO:1901214	Process	Regulation of neuron death	IMP	21085126

Other IDs

• MIM: 606988
• HGNC: 17433
• e!Ensembl: ENSG00000187446

Protein

• UniProt ID: Q99653
• Protein name: Calcineurin B homologous protein 1 (Calcineurin B-like protein) (Calcium-binding protein CHP) (Calcium-binding protein p22) (EF-hand calcium-binding domain-containing protein p22)
• Protein function: Calcium-binding protein involved in different processes such as regulation of vesicular trafficking, plasma membrane Na(+)/H(+) exchanger and gene transcription. Involved in the constitutive exocytic membrane traffic. Mediates the association be
• PDB: 2E30, 7DSV, 7DSX, 7X2U
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00036	EF-hand_1	114 → 142	EF hand	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. Has been found in fetal eye, lung, liver, muscle, heart, kidney, thymus and spleen. {ECO:0000269|PubMed:8901634}.
• Sequence:

  MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
  PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
  LYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
  EKVDVEQKMSIRFLH

• Sequence length: 195

Pathways

Reactome:

Hyaluronan uptake and degradation

Associated diseases

Unknown
Disease term	Disease name	Evidence	References	Source
Distal amyotrophy	Distal amyotrophy			ClinVar
Spastic Ataxia	spastic ataxia 9, autosomal recessive			GenCC
Asthma	Asthma			GWAS
Ulcerative colitis	Ulcerative colitis			GWAS
Hypertension	Hypertension			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Alzheimer Disease	Inhibit	32397415
Atherosclerosis	Associate	10700443
Carcinoma Renal Cell	Stimulate	20304964
Coronary Artery Disease	Associate	10700443
Fibrosis	Inhibit	37924785
Granulomatous Disease Chronic	Associate	10452961, 10910929, 21190454
Granulomatous Disease Chronic Autosomal Recessive Cytochrome B Positive Type I	Associate	10910929
Hepatitis B	Associate	36715515
Hypertension	Associate	12729892
Hypoxia	Inhibit	24520084
Leiomyoma	Associate	24520084
Liver Failure	Inhibit	37924785
Melanoma	Associate	11997235
Micronuclei Chromosome Defective	Associate	32397415
Neoplasms	Associate	9781666
Neurologic Manifestations	Associate	34108458
Pancreatic Neoplasms	Associate	21118808
Sleep Apnea Obstructive	Associate	21902598