Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
112609
Gene name Gene Name - the full gene name approved by the HGNC.
Melanocortin 2 receptor accessory protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
MRAP2
Synonyms (NCBI Gene) Gene synonyms aliases
C6orf117, bA51G5.2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q14.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that modulates melanocortin receptor signaling. The encoded protein has been shown to interact with all known melanocortin receptors and may regulate both receptor trafficking and activation in response to ligands. Mice lacking
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs587777046 G>A,T Risk-factor 5 prime UTR variant, missense variant, stop gained, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030877 hsa-miR-21-5p Microarray 18591254
MIRT1157505 hsa-miR-1302 CLIP-seq
MIRT1157506 hsa-miR-1343 CLIP-seq
MIRT1157507 hsa-miR-181a CLIP-seq
MIRT1157508 hsa-miR-181b CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 19329486, 20371771, 28298427, 32296183, 32814053
GO:0005783 Component Endoplasmic reticulum IBA
GO:0005783 Component Endoplasmic reticulum IDA 19329486
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
615410 21232 ENSG00000135324
Protein
UniProt ID Q96G30
Protein name Melanocortin-2 receptor accessory protein 2 (MC2R accessory protein 2)
Protein function Modulator of melanocortin receptor 4 (MC4R), a receptor involved in energy homeostasis. Plays a central role in the control of energy homeostasis and body weight regulation by increasing ligand-sensitivity of MC4R and MC4R-mediated generation of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15183 MRAP 13 99 Melanocortin-2 receptor accessory protein family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the adrenal gland and brain. Not expressed in other tissues. {ECO:0000269|PubMed:19329486}.
Sequence
MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFM
FFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFGRPLE
PDKVFSRQGNEESRSLFHCYI
NEVERLDRAKACHQTTALDSDVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGED
DLLISEPPIVLETKPLSQTSHKDLD
Sequence length 205
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Growth hormone synthesis, secretion and action  
<