Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11247
Gene name Gene Name - the full gene name approved by the HGNC.
Neurexophilin 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NXPH4
Synonyms (NCBI Gene) Gene synonyms aliases
NPH4
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q13.3
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT030127 hsa-miR-26b-5p Microarray 19088304
MIRT037557 hsa-miR-744-5p CLASH 23622248
MIRT037557 hsa-miR-744-5p CLASH 23622248
MIRT1200699 hsa-miR-1245b-5p CLIP-seq
MIRT1200700 hsa-miR-1254 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA
GO:0005576 Component Extracellular region IEA
GO:0007218 Process Neuropeptide signaling pathway NAS 9570794
GO:0045202 Component Synapse IEA
GO:0050804 Process Modulation of chemical synaptic transmission IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604637 8078 ENSG00000182379
Protein
UniProt ID O95158
Protein name Neurexophilin-4
Protein function May be signaling molecules that resemble neuropeptides and that act by binding to alpha-neurexins and possibly other receptors.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06312 Neurexophilin 69 166 Neurexophilin Family
PF06312 Neurexophilin 221 308 Neurexophilin Family
Tissue specificity TISSUE SPECIFICITY: Expressed in brain, spleen, and testis.
Sequence
MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQLPEPRSSDGLG
VGRAWSWAWPTNHTGALARAGAAGALPAQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKF
SLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEFGGV
WLPGPVPHPLQSTL
ALEGVLPGLGPPLGMAAAAAGPGLGGSLGGALAGPLGGALGVPGAKESRAFNCHVEYEKT
NRARKHRPCLYDPSQVCFTEHTQSQAAWLCAKPFKVICIFVSFLSFDYKLVQKVCPDYNF
QSEHPYFG
Sequence length 308
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Colorectal Neoplasms Associate 38613793
Neoplasms Associate 35758021, 38613793
Urinary Bladder Neoplasms Associate 35462469, 35758021