Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	1124
Gene name Gene Name - the full gene name approved by the HGNC.	Chimerin 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CHN2
Synonyms (NCBI Gene) Gene synonyms aliases	ARHGAP3, BCH, CHN2-3, RHOGAP3
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p14.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that contains a phorbol-ester/diacylglycerol (DAG)-type zinc finger, a Rho-GAP domain, and an SH2 domain. The encoded protein translocates from the cytosol to the Golgi apparatus membra

Show/Hide all(61)

miRTarBase ID	miRNA	Experiments
MIRT890926	hsa-miR-1184	CLIP-seq
MIRT890927	hsa-miR-1205	CLIP-seq
MIRT890928	hsa-miR-1290	CLIP-seq
MIRT890929	hsa-miR-1302	CLIP-seq
MIRT890930	hsa-miR-132	CLIP-seq
MIRT890931	hsa-miR-198	CLIP-seq
MIRT890932	hsa-miR-212	CLIP-seq
MIRT890933	hsa-miR-3122	CLIP-seq
MIRT890934	hsa-miR-3148	CLIP-seq
MIRT890935	hsa-miR-3158-5p	CLIP-seq
MIRT890936	hsa-miR-3167	CLIP-seq
MIRT890937	hsa-miR-3199	CLIP-seq
MIRT890938	hsa-miR-3913-5p	CLIP-seq
MIRT890939	hsa-miR-421	CLIP-seq
MIRT890940	hsa-miR-4298	CLIP-seq
MIRT890941	hsa-miR-455-3p	CLIP-seq
MIRT890942	hsa-miR-4704-3p	CLIP-seq
MIRT890943	hsa-miR-4709-5p	CLIP-seq
MIRT890944	hsa-miR-4778-3p	CLIP-seq
MIRT890945	hsa-miR-505	CLIP-seq
MIRT890946	hsa-miR-5096	CLIP-seq
MIRT890947	hsa-miR-511	CLIP-seq
MIRT890948	hsa-miR-520d-5p	CLIP-seq
MIRT890949	hsa-miR-524-5p	CLIP-seq
MIRT890950	hsa-miR-548c-3p	CLIP-seq
MIRT890951	hsa-miR-665	CLIP-seq
MIRT890952	hsa-miR-876-5p	CLIP-seq
MIRT890953	hsa-miR-3126-5p	CLIP-seq
MIRT890954	hsa-miR-4419a	CLIP-seq
MIRT890955	hsa-miR-4510	CLIP-seq
MIRT890956	hsa-miR-4672	CLIP-seq
MIRT890957	hsa-miR-624	CLIP-seq
MIRT1964121	hsa-miR-3941	CLIP-seq
MIRT2200277	hsa-miR-200b	CLIP-seq
MIRT2200278	hsa-miR-200c	CLIP-seq
MIRT2200279	hsa-miR-202	CLIP-seq
MIRT2200280	hsa-miR-2117	CLIP-seq
MIRT2200281	hsa-miR-217	CLIP-seq
MIRT2200282	hsa-miR-3120-3p	CLIP-seq
MIRT890953	hsa-miR-3126-5p	CLIP-seq
MIRT2200283	hsa-miR-3127-5p	CLIP-seq
MIRT2200284	hsa-miR-3150b-3p	CLIP-seq
MIRT2200285	hsa-miR-3662	CLIP-seq
MIRT2200286	hsa-miR-369-3p	CLIP-seq
MIRT2200287	hsa-miR-4257	CLIP-seq
MIRT2200288	hsa-miR-4273	CLIP-seq
MIRT2200289	hsa-miR-429	CLIP-seq
MIRT2200290	hsa-miR-4418	CLIP-seq
MIRT890954	hsa-miR-4419a	CLIP-seq
MIRT890955	hsa-miR-4510	CLIP-seq
MIRT2200291	hsa-miR-4666-3p	CLIP-seq
MIRT890956	hsa-miR-4672	CLIP-seq
MIRT2200292	hsa-miR-4689	CLIP-seq
MIRT2200293	hsa-miR-4698	CLIP-seq
MIRT2200294	hsa-miR-4784	CLIP-seq
MIRT2200295	hsa-miR-509-3-5p	CLIP-seq
MIRT2200296	hsa-miR-509-5p	CLIP-seq
MIRT2200297	hsa-miR-545	CLIP-seq
MIRT2200298	hsa-miR-548p	CLIP-seq
MIRT2200299	hsa-miR-597	CLIP-seq
MIRT890957	hsa-miR-624	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001675	Process	Acrosome assembly	IBA
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	8175705
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	7614486
GO:0005515	Function	Protein binding	IPI	16628218, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0045202	Component	Synapse	IDA	8175705
GO:0046872	Function	Metal ion binding	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

MIM	HGNC	e!Ensembl
602857	1944	ENSG00000106069

Protein

UniProt ID

P52757

Protein name

Beta-chimaerin (Beta-chimerin) (Rho GTPase-activating protein 3)

Protein function

GTPase-activating protein for p21-rac. Insufficient expression of beta-2 chimaerin is expected to lead to higher Rac activity and could therefore play a role in the progression from low-grade to high-grade tumors.

PDB

1XA6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00017	SH2	60 → 129	SH2 domain	Domain
PF00130	C1_1	215 → 267	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00620	RhoGAP	291 → 444	RhoGAP domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in the brain and pancreas. Also expressed in the heart, placenta, and weakly in the kidney and liver. Expression is much reduced in the malignant gliomas, compared to normal brain or low-grade astrocytomas.

Sequence

MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRF
ESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNEPRKT
NVTHEEHTAVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANVYPDINIITGALKLYFRDLP
IPVITYDTYSKFIDAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDN
FMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF

Sequence length

468

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Triglyceride levels in non-type 2 diabetes	N/A	N/A	GWAS
Oligodendroglioma	Oligodendroglioma	N/A	N/A	GWAS

Show/Hide Text Mining Associations (23)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	26315110
Carcinoma Squamous Cell	Inhibit	18520037
Colorectal Neoplasms	Associate	34302946
Coronary Artery Disease	Associate	24725463
COVID 19	Associate	34185889
Craniosynostoses	Associate	19720790
Diabetes Mellitus	Associate	28068899
Diabetes Mellitus Type 2	Associate	27448167
Diabetic Nephropathies	Associate	20460425
Fetal Growth Retardation	Associate	19720790
Growth Disorders	Associate	19720790
Insulin Resistance	Associate	19720790
Kidney Diseases	Associate	24551085
Kidney Failure Chronic	Associate	24551085
Latent Autoimmune Diabetes in Adults	Associate	33391182
Lupus Erythematosus Systemic	Associate	38347676
Lymphoma	Stimulate	12716467
Lymphoma Large B Cell Diffuse	Associate	12716467
Myocardial Infarction	Associate	24725463
Neoplasms	Associate	12716467
Neoplasms	Inhibit	18520037
Obesity	Associate	28068899
Osteosarcoma	Inhibit	18520037

CHN2 (chimerin 2)