WIF1 (Wnt inhibitory factor 1)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11197
Gene name Gene Name - the full gene name approved by the HGNC.
Wnt inhibitory factor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
WIF1
Synonyms (NCBI Gene) Gene synonyms aliases
WIF-1
Chromosome Chromosome number
12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
12q14.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene functions to inhibit WNT proteins, which are extracellular signaling molecules that play a role in embryonic development. This protein contains a WNT inhibitory factor (WIF) domain and five epidermal growth factor (EGF)-li
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT017148 hsa-miR-335-5p Microarray 18185580
MIRT054892 hsa-miR-374a-5p Luciferase reporter assay 23321667
MIRT438437 hsa-miR-181a-5p Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24755295
MIRT438437 hsa-miR-181a-5p Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24755295
MIRT438437 hsa-miR-181a-5p Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot 24755295
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
SP1 Repression 18701434
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA
GO:0005515 Function Protein binding IPI 19188438, 21743455, 22986341, 25416956, 26342861, 32296183
GO:0005576 Component Extracellular region IBA
GO:0005576 Component Extracellular region IEA
GO:0007165 Process Signal transduction NAS 10201374
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605186 18081 ENSG00000156076
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9Y5W5
Protein name Wnt inhibitory factor 1 (WIF-1)
Protein function Binds to WNT proteins and inhibits their activities. May be involved in mesoderm segmentation.
PDB 2D3J , 2YGN , 2YGO , 2YGP , 2YGQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02019 WIF 38 → 173 WIF domain Family
PF12661 hEGF 218 → 236 Human growth factor-like EGF Domain
PF12661 hEGF 250 → 267 Human growth factor-like EGF Domain
Sequence 
MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSE
GKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVN
VPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQA
ECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVN
CDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGY
QGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHT
PSLKKAEERRDPPESNYIW
Sequence length 379
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Wnt signaling pathway  
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Show/Hide Text Mining Associations (91)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aberrant Crypt Foci Associate 38554332
Adenocarcinoma Associate 18005197, 23686431
Adenocarcinoma of Lung Associate 31698633
Adenoma Associate 24350795, 24876755, 25432628, 27896617
Adenoma Pleomorphic Inhibit 24853424
Adrenocortical Carcinoma Associate 24755523
Aortic Valve Stenosis Associate 36199424
Arthritis Psoriatic Inhibit 20376066
Asthma Associate 19926868
Astrocytoma Associate 20334650, 23328978