Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
11186
Gene name Gene Name - the full gene name approved by the HGNC.
Ras association domain family member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RASSF1
Synonyms (NCBI Gene) Gene synonyms aliases
123F2, NORE2A, RASSF1A, RDA32, REH3P21
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p21.31
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein similar to the RAS effector proteins. Loss or altered expression of this gene has been associated with the pathogenesis of a variety of cancers, which suggests the tumor suppressor function of this gene. The inactivation of thi
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006022 hsa-miR-373-3p Luciferase reporter assay, qRT-PCR, Western blot 21086164
MIRT006022 hsa-miR-373-3p Luciferase reporter assay, qRT-PCR, Western blot 21086164
MIRT006022 hsa-miR-373-3p Luciferase reporter assay, qRT-PCR, Western blot 21086164
MIRT006022 hsa-miR-373-3p Luciferase reporter assay, qRT-PCR, Western blot 21086164
MIRT006022 hsa-miR-373-3p Luciferase reporter assay, qRT-PCR, Western blot 21086164
Transcription factors
Transcription factor Regulation Reference
DNMT1 Unknown 24247422
SP1 Activation 19450668
SP3 Activation 19450668
TP53 Repression 21364923
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000922 Component Spindle pole IEA
GO:0005515 Function Protein binding IPI 11857081, 12762840, 14729613, 14743218, 15109305, 16810318, 18347058, 18566590, 20562859, 20920251, 21134643, 21199877, 23455924, 28514442, 32296183, 32814053, 35512704
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 14743218, 18566590
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605082 9882 ENSG00000068028
Protein
UniProt ID Q9NS23
Protein name Ras association domain-containing protein 1
Protein function Potential tumor suppressor. Required for death receptor-dependent apoptosis. Mediates activation of STK3/MST2 and STK4/MST1 during Fas-induced apoptosis by preventing their dephosphorylation. When associated with MOAP1, promotes BAX conformation
PDB 2KZU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00788 RA 202 292 Ras association (RalGDS/AF-6) domain Domain
PF16517 Nore1-SARAH 299 338 Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain Domain
Tissue specificity TISSUE SPECIFICITY: Isoform A and isoform C are ubiquitously expressed in all tissues tested, however isoform A is absent in many corresponding cancer cell lines. Isoform B is mainly expressed in hematopoietic cells. {ECO:0000269|PubMed:10888881, ECO:0000
Sequence
MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERD
TNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDS
GEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEAL
HACPLG
Sequence length 344
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Ras signaling pathway
Hippo signaling pathway
Hippo signaling pathway - multiple species
Pathways in cancer
MicroRNAs in cancer
Bladder cancer
Non-small cell lung cancer
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Neuroticism Neuroticism N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 14511407, 17967182, 18494062, 19926549, 20193080, 21102258, 21507233
Adenocarcinoma Inhibit 18182852
Adenocarcinoma in Situ Associate 21731750
Adenocarcinoma of Lung Associate 21731750, 23902976
Adenoma Associate 17923875, 18182852, 23764768, 28600574
Adenoma Inhibit 23865079
Adenoma Liver Cell Associate 16606445
Adenoma Oxyphilic Associate 31773698
Adenoma Pleomorphic Associate 21063414, 23510689
Adenomatous Polyposis Coli Inhibit 39607643